08 FXW<   FN)/mnt2~|~  w7FXW@@<@T 08 FXW<   FN* * FXW@@<@TU n7Fin7FRueAz7FP"#p7F[%p7F[%JC FЯS, FЯS, FЯS,gumby2i;n FЯS, F- F-gumby2#0 F- F؆. F؆.gumby2WS F؆. F(%. F(%.gumby2Zl5V F(%. FN/ FN/gumby2k FN/ F]/ F]/gumby2  F]/ F00 F00gumby2c[FX &Fxc;&Fxc;PX`hpx Š@ F(bQ F Fgumby24j F FHx FHxgumby2nU  F F/ F/gumby2G&F`,&F,&F,gumby2OzL48 $e*z3\]8|71x?e^ǴIҟqj<s@Em25J}#Ld}G^*<Q9| m  JqB%.{}-7$p2+aa_n5){fI)T H}gVHTs^ HSgojCOZX43>8{Prde\Dc5 ڜ"hǣ 1ʋSśl45kTq SzAa;6YOpg4!\kQy}0 wd(rk`I 8;:c}5I0"{( 50Q?340a . hNPD-x4ycf0ҫ&R27`_#f,:ϘE*+e Zx"y+o K qà!U2 m4U\f{Mph $PY'w@qvs?r<=[>zU40#Esw~Of.8`͞~Ydɬc\a]UJ @X8wMk8T5?;8\8C04HǻA*6S֩frj:}ZT,`j_"U3d'oG,P YL'}z +X khe8&'5]@t$ x-ItC k[R#Z4|Ql W.q{cWwdܒcʟ~tuԝ*#C-T(f,a`YL\`^VC #78ou+sE lXޮsܳ(Xq`L\,w8n -HȕSp׼ KkQq)&_3Z'ÓҦ!ӴQ LS@ vOX&B?A59 VIe= LPSfnh%uxd%5B9+qQa YR)\yp_N98YUVsqFL;$<r5|.7&m\,Ja5HDrvg̟xiFB; q;Jr4wyeyu {#A-"0Ei;Jo I7l*VGD)~oRgF&0 1 .=nPSp8TRp~AzgA`PH\gcwE?c)TM܏|1?q, ctݕ'(tCeƛ:-Iroq*< )@ zekbu/)X9RU6U ;}k3TcN5]Q6t!_SM;KR`p|qEzWrZa7@34 .G/9z66Μi 뉵#`ND)] ?UrQr{Gov@u`:C\&m@ ,Mmh{7fY]cg4;;)xz:4; zc}(3Tf!A;=r+$PI\~GI\7xczQ’6:\uzh 7i  . .. lib vii sysinst pax newfst lesst hostnameso  gzipame gumby2e edb  domainname  disklabel wiconfig cshdhclientdhclient-scriptfsck007fsck_ffs79a passwds pwd_mkdbscr progress.gz sedELFa(4# 4 (uU uU xU xU xU bwNetBSDЪ -L0̀ -L>P@0! MP@ -LP`pM @0T0P /* P0@0p0 0 R`0`X P0 < ,0x xU d>`;( 0S S -QL@` PM0p ^ ! \ D0  0nHzPld> 0-LpMlP 0S0\@0 R 000 R,00S$000D4  -L -LXMT0 0S DD4 0S $0 R l3   -L0L Q0ἴ -L`PBM M  P@8$ p<$ @$ D$ H$ L$  T t  P b@bP4+4;4 @T(;(+$; P;pp@T@4S 9P:D$R H4Sz L$Rq WdY: R:  N Z  2P9 J 0Z% d*048$ < SC00 Z *048$ < S0 Y$ 쉟IB40 n             84S0A00 L8F2P <)080000#y @T WP0 S t00S} PUPz#PU@ BnK`F`F $P04U@ PU t00Tt0 WF @TPUW.HP0s BK@r/ @ 4t &P* P4P L0SR G0'S7 D7 R0S y:`'`4y H0 0m㌯0 0p xx0 Rv>x0ꤖt <$RA]l8P 0 ╺>     8 0 V4c4#8888C#(b$"((("($$0P D0B400 9 P 0 |h u%%BNK@D0%㷄7 并P5x島P\5~d孶P\5uPWP@T < 8c4#888#8C$0 0a!!GN5P4 <,P @T 0H4 !`46xP @T 0@4 !3'@P @T 0D4 !4P @T 0L4 !3 P3 P2 0#0ަP@T !8$ hѦP@T <ŦPx00  彦P <$  嶦P@T >0 P &k"000哦PA x卦P1W 1 -R5 BK@0@ ,4 +!P% P,@DjQ 4!0,&!,4 t r,!0! ! FV @d[Ih4<$ L0p-  @# <d H , 0V 4 D Lt @ @8V  dV V V Ԋ V 8V V   8 $(,04 8LX\ -LD DDb@`<^8\44/00,,hV dV V V (4d M Ѝ -LP R 400`pp h 0R0 0-  88@$00L`0@0&0D0h9 1 00 S0/"?C100 0S0100 0S010 0 0S 01 0+0@围 0 00@咴00Tk0@儴I00J  @ L  p-L@M L0Q,0 Q |!|1Q,  R 0SLM  @I  RC PP nJ00ph4 0 P(0  00PP 00rk` 0  `(0 0! 6H Rp 0H0 0DPp, $,4<D L -LP@o`(M T0806 ,@ (@ $@ @ 08$UpW,K0 & @ 8@ p`)EP $0S@( $00 `0 @ 0 0 D (#$@ $00 @ L0L 8/1  @㓴64 R8@ 4@ 0@ ,@ y84 \SPPp L00MN @8K8Ÿ 0 P@_CP^ 0 R40M.8K8 20 ,0S @0, R @?TN. PP$6  ,L$ 00 l0S @0l R @?TO.l cPP(  l.( 00800@80$!0 0  ƚ@ $+8 RPP} 64 Ry L00 8K8@ 0 PBPg 00S-  ]2^4 &4L4 (xKUL @ ,^ P 0-L@M,xPU0 0 80S PU0U0 0 0CS0 }P0 0SS S S0(@@h8G P0 A0 0S0 00h& -Lp M␒V0@ `bV R!,0S LQ 0S@L0R8@6, L  L sP Tj D0SV0D0[D$0QL0@  Q0`0D0V0Y0ǥ8#8c4#888#8C$Y X0X `B4=0<  04Q0 4c4#888 Q#(0DD0 PP`F  0 =[D0  0[OV@$ϧ@@D@D@@ŧ@D@VDQV0D0VDuo   , -LPMH @| \J0S3(2`V%p  R/6@0 0@O@e6僧1 @ 0`h ;1 R ddC 0S  0S\00 \00 T @q 0R0S 0 00ag 0, ~  R P`  0 R0b 0 0 x0`0 0\ p  P|D -LP Ms @0PP`c 6 V0 0hQ P 0 RD0S&0D0$ D0S| P D0 0S0a0D00\\ 0 ,0 (0 $0  0 R(0(0 (K  2 0@A$S) K0 +0K0, K*K00 0 0 P< B4Y0X  V0Y0ť8#8c4#888#8C$Y X0,0`#8c4#888(#HQ0 D0T(0s 1P0@,K6P @YD0 0D60,KP P`O4D@R@@D@y,D@@I@D@&l   R t R0 0AtL0S; 0, R7 PZP& 0, L +  X <D -L`pM@0DdD$HHP0 4D QH$H0D 8V@,   09Y  -L 0 M4 0 , ( Pp(8 3K@`Č0 4KL` ``1K2KO P^4@$HdD$HH0QH$H D0dv`0^P4K6P  4K68X颷 4`X -Lp@$M \4 8 0p `hq.  -T HPU,p V ̉ ,K0r0AŸ00PkrΠ ,K08 0PRV- 0S 1S0@Ks>h!0,Pl 0S 0 1 01SsΠ00,K O0Pƙ0S 40S8040@ 00 0@ , O-,Kh 6PX, O,KDs.-P, 0~Or.,K #P q.,cL H_ x_ _ @ -[.LP`@,M0  !0K(PK( 宯T000! K6 0pP+(00p ppppp0 00Ɩ4@ @Hv. ,6KSK?3650P0 Q 00CR0SpgXpTYpXP0Z00[ [phZpd0\0`0,孯 R  Bl⥯@ L -[.LP@` 0,M!0KM Rd R00R0S00b^0! K PpP(60p ppppp(1 00Ɩ4@ @?Hz. ,6KSK?3650P00Q0 0 B80CRR0TSpXpYp \J[pZp 00CS0`0d0h0 R  Bl8hH 3\p*XP0Z0[ 6 8M @ L  -L`p@06 ,M8P!0K(K(p PPM0! K@N[. ᾮ(00p ppppp0 00Ɩ4@ @G~. +6KSK?3.65 +0P0 0Q0080CR0TSpXpYpWP0Z00[ [phZpd0\0`0$Ʈl  @ L -[.pLP@`,M0 !0K(PK(p e86 |M! K0ppP(00p ppppp0 00Ɩ4@ @cG0KS6.K?365 9+0P0 Q 00CR0Sp T\XpYpZp[p phdp `p$jl e @ L -L@!- M$PX(0!-SD !-08 *!- h(~|L -L`qPSTA-p 8wP$h1`V xPU @T  0{@T Q(PU`V0`V xPU @T  0`@T QPU`Vh 0M 0H;w4 V 4 h -LP4pK(M@` T( 4 0 ,  P 儀t`< P0 0 , I H0@ 80@`. , Ԋ L4  -RLP,M<0 F0S00z40@Te-Np Mv%P!@0@ |`40EX5 D \`0S6 R& @@5b q`0S(P$0S,P0S080 @40 00 ,0 8 0Ttd  0 @`O8 0TZ 0v> 0  ,`빭0SCm Z 0v> 0  `럭0SOZ 0v> 0  X_놭0S10 4Ŝ}0S#w0S< 0R0Y00SY0 @PLZ00U00P00K00F00A00N.( UP@A 1  _.0S. 2$00.( UP@! \! _0S.l 00.D uUP@ 00 h_0S. w00000P_ݬ0S ٬00Ԭ00@ 0 ɬ0S Ŭ@꼷 4 V ,8L@ < dL 4D -PLPp`M P @. "T0\$6 6!\V  0t| t0p+X` \04H 40D, 0LԊ PX`DJ d -L4pKNP` @JMP@4P 0P ,P (P ` 刀@|:P ,0MKS  P0 0KPG 0p&- )L -L`pPtM |p x D` "2R8 8 4 0 , 'JP@ Π 8娒8K Ÿ0 @*:P 0 R:'-8K\ )(\+$\!8 0@T $$b  0|K @`M8 0T !1 !1 !|14HK00.8K\ L0 e)LK0 `K^`0S `KP_  !08 IP@ 8'͠8K 0 @9PLKT0Kt@K  `K5_t0St d_ @  0hp @ L< |h  -L,@K0XM"B 16X0p1$&! 0!1. P`Q 1P  0P1 XA  P 0P1 (1@1 A4p 0@ {PP*0 8pKyP00P@@TPX P @.rT0$6 6.t gx_]80 #4b\8@ P4K 4[ L W   0--LBK0@M @\pᦩP ᣩPP P. `PV [ [Ꮹ WP= 0:u\b. 0 $6 fBKAl[Lp@-`0 \@ 0S _P\p-SP0 0ST\p_00 @T00p@ 0-L0 R @T00P0@P db`tNP P p0hT@A00(;x#[뤷 ( 0-Li/XP'PLL $r@T8 0 k\0hr0hV @Th 0-L0PU0 x@T 00CS 00(0D 0 0@TPU0 4 , p-LP,M Q8t l d \ T 0 0p4 0@8,6 (@ $@ @ @ GP` @ (K 080N `@7P 0S!$000 @ @L@6 D  | R dCP=@($ ᨨ$@, @ L0p K. G Q x.P` x:>  03 . . PK@%>0X #.H < Q >$ 0 .  h L -L@MlaQM>X!0hPU t0#1 , PU1PWPU t "1 PUx@0Tt0 p`0 0㾜0 0`; @TPxxx0 R\Fjx0>$ 0.  4 L D -L}Y p-LPM0`V! x@T U@@x 0S 0SƔH0S @T`VU pD0 4 0(k4 x 0-L@M 0SLP0  0 cP 0(0H H0 -LPTM(6S P  FP` Ÿ(Fp\KŸ 0@ `p<6P( FP` (Fr儒 \K 0@ `p!6P@ (, 8@ 4@ 0@ ,@ EP` (ˠ8K 0 `5P(= H@ D@ @@ <@ X@ T@ P@ L@ EP` (ΠXK 0p `@5PF HK0 @T8 0a0S, 00S @0S X 00H0K0 08K` .8K $%.HK %`H0K0 08Kp@"00008K@.%T K HK=i.@ XK $ȹ @ L з D -L@`QQ%T 01<00K?000 ^ X1 00P0$0H@`8@80SD  b 0S: 1 E0PUp x@T 6SV fPUT eP` |T 1x@>bd TPx b.x ٥x@P8+0((%꼴 8V W xV 4  -L`PMPp( K( 0(@K[$ \?0P  $F$ \$0FT-@@[醦V -LMPP`@pK@' 0$PK@[ z\?0C/P  P   ]f[V 4 -L@$PK`M z\O?0P NK?0PD C?0P <0P APQ `,pK0 K00` ,` "oP 00S [f3f,\  ^ ^ 0P\ 0S  RP0? )0W" 0 0 ^P4@K?0h)4` G"&. P D)4?="/( , [ \c?0P* ( K'jPp  [aP هe- dV (ˇeb/{kPc/V @@(ḇj [V 'g(ᦇeJ?0P1 KPU [ [_?0P`  [_?0P =0P VV VP x8`;80FS<`5$ d[7 R0 0  Y[P@ K?0P K?0P F[4g >[N?0P >0P /[V80 O?0P [ [,  [0 He [=0PH MR?0PA  P =0P Z Z$ P& Z?0P Z Z$£/ 9PP $U  Z`6 Z`0 Z?0P =0P r?0P` ZVkr Z` %Pr JPK Z Z3X >0P# r?0P $  sZA?0P PA/? 0PP43L$媢P* $ `% VZA?0P$%PP*PP K?0P =Z 9Z$ÑP0H0t$廑P d$嶑P0L$寑P < Z ZAP  Zc?0P ZA?0PP ڗ?A/0P00 PPPU }$ݢ/UP4 pa4$T0U Xq0!4:P 0PU0U4 Y YA?0PJ $P$  Y Y`( Y d`xx(<TpW  <P`|  < $Lh -Lp ,K M0  yY;P9 A?0PP`ڗ?A/0P00 PPT`Q@,P @T TH 0PP> Z00 P@ `HY,P ;P E1c00@X@ / 00P `Z00 HV101Z ` D/V0(^ , (\ xx -L@ `KpPM  $ XA?0Px b$K ZPO U? (K$0x(PPx 0 0 0S(6S& t00t00 X{P X? 0R }R (0$&Q Xh屄$$x0S x0(0 x$0x 0  0T -L`P1M@0T$0  DގPW @T$K$0S"`10S$0 D͎P< $00S$0 (/o P+$AD 0T p/Q  X~1>08 C $0S$K? 08 4 h xt -3.L@b M4x0P0$ b. hPx /0- @LPT_0P6p T ) =P 0?P4 000h,P 0$x -L0@$pK M `(0 ,0 W{P dŃaP</!PP < ᧠4 0 0/408 JPw  WϠ ^( K,0Kf }^ s W(PR x0SR ,0S(0x`,` X(0x P ,`@Tp 0\ `' Vp@,`X00P P 0 R 0R 0 0  PjP,`,0 (,`jP40  0RW,0``x( x0 (4 xuqx 4 -L@P(K`pM  W>0P bAPN #<0P <0P `  V;P ``bP ( 'aB?0P G?0P$  VP xPU 0SPUЂP($PUĂ,pK,P ĀP ,  08Q?C.x ?MPD >0P >0Pd cr?0P OP, A =0P40040  VA?0P PA/? 0PPn0(帞P`j( `kc  ]VA?0P,T(TLxlx<P -L`M0SP P0S P0S(pK 4VA?0P)(F. P@ (QU00@@ PV,P00X00S;P (_S xx -LP`0pKMfa0-S | U@Tl 4K 00DD@U,P ;P $ځ_xx -L@MɁ_$0 S p-L`MP@Tp t0 0S0 00S DL < 00@V000p Lķ -L@K M㚾PP t -PL`pl@T UK 0SH @T Rp0 P \ 0  P  k$ /  -L@`pM0 P'P P0S 000S.:0$K0(l 0AϠP BϠ 0B/  >$ 0  -L@`pP@M0 P3;P0S+ 0S0\PK 0NṛK/1P M?PP 0SU P '$   p-L@P`M0 R'p0S R 00SpPp $PpPp$ / -0LRP`M$0 N $pK!0ᯞP$0.@ 2T0p!0QO`!0ᕞP@ED1Q(  R 0 g/ ($0 (PK@aϠ0 P a/  R (0RR.b/ eb/ ,>( 0. S ^/ ' p@ .P  & -L@`0M R'0H 0 0R 0 P0 q/0$   -L@pP`M\'ᐞP P 0\ 0 *PP KP P00(  -L@pP`M\'] ~ϠRl0 P \ 0  P  ( 0 P'( -LL0 P'0P 0S00P ( p-L@P`M0 R'ptPpPpPp R 00SpPp (  p-L`K^PM0   8@T &>| 0Cp0.%.@P Tp@40/\ 'pP .K; Bt8 ~Kp( pG pG  P vp8K@S t t \ 0S p8 )0S YYX YV Y ` V<!KH0PP0` ` I) G ϕP7)@TxH '8(8C8  x8S 8C80#0Y00S x8S 80S0S S t8V>K0CP.T iYr H0Q`|8 x8 dxHT? |8SUQIt 800Y00S0t0p\t0(0SDV @/ |QxH0SxWQi?X'0K/<@ |QSxHT7@TxH  t0#12 0S@x8  YP! &0S F0S X P \X0S  P)x&00?``H\X|L6L  ^PxHx D?K%@0f%>%0`/]xH/ VxH?h%0Nu\0S|Q?8%08j -  >t0P KN`0SYC 0S  R $0S$T8(0 RxH(0 T0( =xA=xx8X Px(\X0S  P *.K$@ |Q9 K$@?x,DxDT%x D{x>P tqnxHx#Dda^x(D 3X@8K@/|Q ?K"@0EK@#>@"0xHK@/@ xHK@"? K @Ⱅ4T(0RxH3 p0S!MK@D @D 0K @l8 坕20S` KAxAY0W/@ P   !MK⃕@Dx8( @Dp . zxHt000Y00S4x8  0S  S) x8 x Xx(000xG/K@ PxDFxZK@I/0@xH Y CDPP x8@TxH 408 /,rXp4 d h ȷ X Ԋ ," X ,<`<L\P l0 R0X0 -L`pPMP0D l00S  0@0T0{TX P  -LML0@T ~;{;@T$0P0 o;4 X T -LPAMM0 R'jK$`F8`F4KHK* 0<@Tp0K XK 0Sh R\ p\K  @40@#8"D  @  -LPp`M\ P@00CS R'D 900D@P 0\ 0 *PP  /  p-L@P`M0 P'ppP0S`P x0S0x00SpH/ 30`0 *0p0  p-L@P`M0 P'pP0P P% P0P P P00SP 0Sp Pp pPP 00S  7 h 4 p-L@P`M0 R'pl忺Ppt0SXXʺPp R 00SpPp  d% L -RL0`PpM.$0  $K,"0kP$0k/@ T0!0Ql!0QP@G1@T DP ̄0dDC$0P0S I @T\1@T DP ᴄ0dDC$0P0S - @T/ P0 PT S P. ;S/l /T ,]P]PT/ 'U@ 0 p@tA.P   p-LPM\1@T T @TpP> `B.  sQB>! 0/0S&T @Q=0 \00Sᖱ9y:pC>t 0GC.\ CC.D =:B.( 5Q  C>4 h H -L@MT0sd; PXQXqF>D!00T R00$1i60` PF.SP` p!ב00Q0PT0`P ! F. DpP0T0 00TRLp0!R 0T0 S000!RT0` L <  -`DL4P᎑hp@G>^T 08@@tP<=, 0h-4  -Lp$0DP Dß@ L00`x0`D  .t j]/P`  D0 ALl4[/LK`% R  0P C/8P<0  <@ M%P`6 0S@+<0S M/ P@ P 00=0< L", x8N/*` 0  0   MϠ@K/  F/P`X 0    <  {G/ P <0 bA 0 00`V=I/H `080 8PK40 00 ,0     0 0 P <  0SP6x6668 0 噿o/ 8 0 8 0 lC8 0 T  0  06@K O0n <@Lp -LP`pM 0T,0  \ 0 T 0S^ , 0 ou ,0  p-PL@P`M P 哿p00CS000pu0Sn00CS88x98L9L9L9L9L989l9x9899888x9 0S  *00p 0S  0S0S    , 0S  .0S 0S    0S0S  0S  ܻr{ -QL`M 0,0 p0 0AS񟗁:<8<<<====:=p>?`?|?(@x@x@@hA  pW [> 0Z~ 0PXƟ HƟH6=   R  @T0S 3> 02~P0 0@R ">} > 0~  > 0 h8A >0 H~,  0Y; =  0} 0 4P䄟P P= 0  @@A Ꮝ@ግ@0@ 0 @ 0@Q  040 <  =0 } 0㠓 0S 0 }w @ @넓 0 t@p 0 w=@0 Lu}  02$ß =Ÿ Ÿ2=@JS=0 R},  0D2Ÿ, <J;=| G 4= 0X3}@ 1<1(Ÿ < 0w1 (08@HPX`hpx (08@H (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx t<  = 0}8100  < 10  < 0d|@0X < 0S @DAPA\A0  < 0-\00 <000$0 < Ԋ   $0<HPX `pxN 9 8  (,4<D -Lp`DM@T  Pn , H D HK@ <  8 04 0 @ŸP @Z 8PK \ 0 @T/HK @Z 0S @TT ?Th!0R  4qP 0@0Q  / 4DaVP:.  :.HK ?T 0LK 0 @TP @Z  \PK 0 @T =P L P0R?L -L@P`PpM1  0PpS#ExEEEEEEEEEEEEEEEEEEEE 0 0\ pPp@T  0 0 0 p-RL`PMp P/p P @K@P0P0p5P0S 0S 0S   㡸P@& + '0  㔸P 0=0 <0 U0 @p  ㆸp -L@ M0P( t00p0 -L$pKP@0 M` RĀ$P $  0%$\  \ 00   JH  P l  -LpP`MĀ0S, ᕊP@' 0 S.R!   P` u<P0.   0P@@V   l  P-L`p @T 00CSPP0"P0S 0S 0S ʷ *  * 긷  -Lp`P,MZ<  P 0S@<S/, Q/  @ b/ 00Ae/   -L@(pK`M@'N0 SP.RPPd,@0S 0SW0SMX5U.`嫶,0P. ;U ,0.  ,00,@!0<0-0  P- ,0 Aq? 0Pq/  ,0   C, 00@0 j/D D),@ ,j/>),@j/ P  -QLP@plM#)> #0P ` D00@K}0   +0K K \0"0^0\ 0 "000&0  M-LQ`P' M| @8K0# pP@`,S 0pGtP@ R00000$p 0P,p0p`1tP@ $ Q0U000@ ,00`P`tP@ 0V$00P` 0000, `0kP< R <08S <哵 T 0U p R00@00`S PpptU<U p R00@00`S PppsU 0sP@V 0$0V0p 000,  P`0p`psP @<  V00$p 0P`00p`,psP@( $ ᵇV0P000@,``0NkP<  0@PS  0Xb  @w  00倸t< q<7\d0D <l M-LQ'(M @8`K0#@pK@#R 0@ < ;sPP <Q@ 0$00 00,  000P#sPP $`@B RP0@P  00,00@P sPPy $`,0S@P P0@@,0P@jp7Zf@@T ` R000P00 S@  ``r@@T@ 0@@ @@rPPA  R0@  00$@,@@00@PrPP, Q@ 0 $0, 0@0 0P@wj"7@@T ` R000P00 S@  ``r@@T 4Z9Z0D MЍMЍ+MЍx곐 -L@ 0 M @dplI1 p-@LTP`Mp 0Sd \  0 ph p7003 0-PUL@T  0S 800@00000 -PLpM `V00CS@@0@T 0SX P D 㮳U@ ᧳v&ܶ -PUL`p 0S |@^ 0 @@@@@@@h 鰶00ꬶ 0-PUL@T  0S 800@00鐶00ꌶ0 P-L`p @T|00CSPP0+0S% 0S0S0S 0S #     C[>0       - LڲP0 0C> 0  ȲֲղԲӲ <β p-L0 P@`M@T0 0PP p骲P@@t 00t -LP` ph0@S00  0hP@p 0-PUL@T  0S 800@00髵00꧵0 00p -LP`p`0@S00  0h6P@鄵 0-PUL@T  0S 800@00b00^0 00ᄵ -Lp @P`P 0 ```h 0-PUL@T  0S 800@00$00 0 -LP` ph0@S00  0h곱P@逵 0-PUL@T  0S 800@00ߴ00۴0 p-L@`M PၱP 0p ph 0-PUL@T  0S 800@00馴00ꢴ0 0-PULl @T\ 00CS0 @000醴0Hꁴ0~0 -Lp@`M⪃ " PP0      5 0i 0-PUL@T  0S 800@00=0090 p-@LTP`Mh \ 00CS 0 0S0 ,0 pذ -PLU`pM℀ 0Sx@A@ ᯰP  5 0 000鸴  0-PUL@T  0S 800@00ȳ00ij0 P-L`p @T崳00CSPP0U1 R d0\ 0PU W 劳<  -Lp@P`2P 0 ``````h 0-PUL@T  0S 800@00R00N0 -PUL`p! 0S0@S0 p0 Tp  q 0h ۯ@"00̷ 0-PUL@T  0S 800@00000 p-PLM PUp00CS@@0p1L0S+,0S"H0SP T` @T0G.ST` @V Vp0 P pPG.H@ EG.,( L寲p̷  -@TL`p 0S| NP^ 0 PPPPPPh 郲00 0-PUL@T  0S 800@00c00_0 -@LT`pMl PU` L P  0 PPP8 0-PUL@T  0S 800@00000 0-@LPQ  0E -L@M0S 0  0 T0Q035 05MЍmMЍ⤊MЍ, -L@ 0 M @݉[@\MЍRMЍ≊MЍ֊ -L@ M 0@‰鑉MЍ9MЍpMЍ⽊ -L@ M 0@婉x - 0L-( ⨃C M0HsP !̀xxßP0hß,P(P\ß\3Xß@ P I>08D@ $ß,@$ß$ß $P c@ PIΠ 004 @PT̟P0 Ÿ2,P(PŸ@4ĊK>08D@PŸ@tŸpŸlŸhŸdŸd 0Ÿ $z00Sp @b@ PKΠ004 @P]Tڴ1q@q=8 00 ,@(@| H$4ć8 =00S0 da@PMΠ00 4@P T AM> 0MΠ 0MΠ 0NΠ 0PMJLG <    0P`l(\ ( ` l@4(l ȹ `8a (| 0 X   p-L`PB M$4P@ `p, P -LQPM p 000$K`( #  >@T  (@0Z  0P @0 0A(K .`@T 1d  p-L@u `M\<PUPp 00 @T{ pp,  -L0M @T,  -LP` Mp P@& @U P 0S 0P0 000  0P, Dѯ , 0 N ¯  p-L` PM0@T$ 0Hp髯p, H Q-L`Pp U 0  @Tpd 0 @0 0U0 , p p-L@ `MDPU8, 0fp@Kp,  -L@p `MtgPUh\ 0H@|( 0 v 0p,  -LpA/` PM=P4 @B?0 TC/ *@E/T  C/t  00@T@ 0pF/,   < -LP@ P U 0X 00  p-.L` PM80Sp@00}M/P e N/ 0 @T 0/0, -LP1M 0R, U?!0x LPp;  0S` `1S8a/q 0 $! b?P@  0R@ 0 *  0@}T5:0 i?. 0, ; J| 00CSh}}}}X ;< 0]/<00 $-$  , d x    -L@4MP)\4 0@ `. -\  P' ".0K jP0@ 0` P@4 RT/0K| %0 j P /<0K >P 000 0` P  P C#.0K #P 000Ϡ  0` P@mK P@ /T0K P 00P0 0P` P 叭V P冭~FPp 0S 0S(0K@,y/  @ P 0  8 ^R< 8 8  D .0@T0Dl 0|~/PDZ s. 0 ` < , 00@8  8 <0 0SR<0 <\ h#/@@ 8^ 8!.@  <Q @ 0  00K@ @/@ @00S, ?l/㮩.@X V P Pp Q 4 R  T,   $ < P t  -PL`p@00CSP0+0Sꬃ0S nh墬P $0Sg'.(4 X $0(劬 ,  -L@PP`pLML@  0S q 7Q+xDDDxxxxDDDxxxxxxxDxDxxxxxxD808DxDTxxh0 LK 0T Ϡ @8K 08@ 4@ 0@ ,@ X PX`TX QR V0"Q "APL P gP@,V#X RVT0XS\ V0"S 0SHK/8K//P ⒨/HKt `@0S,0$0 S+ ,0/. 8@n(0(P f00$DK2{0"0CS񟗲  000 0 0 0/D( (P $D 0X-@$z,0/( *PP  4Kz00P@Ϡ  ` HK 0`<@ H@ D@ @@ `E/`8K X` H=0L0 T pE``?T<H @40,(  , 0 8 d  -L`pDML  P7\ 񟗜ꄐ8888܌88؍؍؍؍ď ,888888888 L DK BPP@ D0S0H0 P0U0TP D0S0 H00S0L0 `HK 0P` ~P DKH D PqP@ D0SP  HK 0PB `P D0S H0S  L0 `DK`P HP@ D0S00Y8 4 0 ,  @ 08K C P 0 D@PL0``kL00-3Vh0L0\R 0L`00SL 00Nd J:Π@< <K@ @P  Ϡ@` 0@KP`TPPM <@ 0R 0L &S000TU /@Kp <K\/Rp p`p 0R CP0S00L00&S00 0R 0R 0L&S0000L`S000 U PL`00\_PL V PLL00NU P@%JP P Q0L@0 xS P< IΠ <KP p@P@ <0 R0L 0J.<K4 (00N(K) &, H x , \ -Lp`\MX 7\ |ܓД(Dԙ`̚4<@ p48ϟ@ P8K @@8@ 4@ 0@ ,@ PPP @P  P 0LK0 `PPK 0`@ YU\ & P$ 0 L0R YXS.8K@  X8KXL0P X@0aS0 000@S P,  @8K8 4 0 PPMP@M  PPKP` 0`QYPP0U0Y 8K0X_0 PRX0 a008KU.`aΠ@ 8K8@ 4@ 0@ ,@ P PPP̟P ` aΠP` 0 PhlHKP<@ H@ D@ @@ `YPPYU b.HK b.8K #@00X < DP@ Xb.8K @ b.HK XX04KwX@00@`KD DwXV^  0  0 @PX 00@P `` S X0  0 X00  W Q` 忧 QH 帧X P$  X 00 00X0 )wX@ W 0S 啧P  0LK PX @P PK P 00MYPP( L Q$*P0SX`X0a0X 0P@  X L0X0@ vXP0\@ 0\RE`\` X 5@0PK0 PX` X` ZP@ X0P[  O&@JpPKpPX >X  8P@ XPt,X@'pPKpP X  P@0 XPCt \ @0X0d @ PK@ q @P ` 08KHƟ` @8 4 0 , t0P0PYP* 0@PPjP`2 XP' XP0 XV0P0 `P@5*0e40d vP@0 PUX55:` Y`Q-8K8 qPs``  @@<5<P`@ 哦R X 0X P@ X0$ uX@0 0M0 LK@@P  P  P 0PK PjΠ  P 0P8K8@ 4@ 0@ ,@ \  jΠ `` 0HK<@ H@ D@ @@ `` ``YU \PX P@TT0 T@PAP@ \ 00@ >9P0 0 i 000, -LP 0.S ), 0-? L@LPPP0 3P L B0-P0 0S000L4 "PP  0 0 L,@0@ P0 Ll0 P0     -L(K@`pM@,0 {0 4 `!PT叙, i0STP * \8 0P 0SU:4 Q 0#Q084@ETeT\wP  8, 4000P00 ((0A4    (\ ( P -L`Ep#P@ @.#P 0S 0V0P00S ̠0WP 0!UP 0PU0qP l0WP\`d0!-hP  0PU02Pd  < -Lp`@PP 0\  0 ER -RL@P`M,@ ,KB? $0P娘,pE *h0,0,0 @ @@, ß0#P\ 0 ,0,0@ 00 ,0  ,@0S0 SR00Pp,@W*0.S pW*0.SpW^0UJU9R0 @``P@P% , 0@@P , 00@@P , @\0@`P . $ F/  E 0 @@P ,@0gN 0@@P ,@ 0t PP ,@00 pQ`*. 0?R0@R< Pp6V`,@00Q:WpGY`VWVWo p 0 0f 0|@@UP ,@` 0D @PIP ,@4ٗ$  X| ȹ 8| | | |   -LS]K(PEKMM KKP$ K4 @TP Tq EDJ?J0ZJ Z#506 4 30$ 8 4 X$ 20Q `4 $  0S: 0 P4 04  0U `$ 4 " 841pX Q JO( K@ V00P0#02S RP`QpW 01pX Q JO( K@ V00P030"S RP`QpW 0p W(K0S 4 4QKV 4R p WKV(0K!+04`K :KJ K%Ky4`@SR]K  M.K B (PE0PE 0@0:K K$$@4$@ 0J#Pp z0P40 000Ʌ ɕ  P`2f:K4S @hTc(KRA0Al $fT @0Tl0 0@Tl K0W0#02S/:KK$4R Ke@``$@ @  MKLK-P 0^0U00S P00( K@fRA0A, e?T @0?Tl0 0@?Tl (KRA0Al e` ePK$ U 3$ 0RS4`. v 8~P`v0Kf4 p%W(*(0K!0pRS4` W:0SJ K^ 0ECJ?Z@KL9 QPr K:K$4 uϠPPH``S0Su/ Xc@ < cSc -LlMJ Yd h l p0 8 t 4 0 , t@ TpW1 g1t!1S p@0LT Qt Pt *0 t P! 0HP RDP @P 8K $0L/W$P x 32 tQp pX@| * X010#P Y` *` V 0i Y*V0iP`h0S|d x0 W 0P U 4 dX@/8K  4 Hdd0 0\PK?@"0\@ /P /`K/8K /HK\4K}d00\DKvd8KD6.6.HK0 \6> "08K4 /8,@ 0 w Ϡ8K A0lp @700SQ/HK 8K/E*pAPM R X1Q 0QT0 P0 L0 X0 0bP0 T  P0S`PX@KHK @lp 0/P 00S(^ T cP  P XKPPPlp 000.0<   (\ Է ط D -SL,0 M  @ ؐ ܐ 0 W   Kc00S` O (0K0 (pK0S 0 0G0A0C3S񟗾p4   0J 0G`0S00p0   0bS r00Y0#02S  R -X 0S R: R `V { p Wk(0K 0RB0C6Sx` R"00T*D4  0 ,@T& TlPT:0S"0000bTP 0 :S R 00Ŵ Rp Q00ŴT Q`R 'Q"Q $Q `Q \Q@\00  h @-F``( (`4"4#0 @öG7` @( K10S `1Q0 0 S`*6bP5` @`ppp"d  H0H"SD `%` RԒr 0 b˒0 iŒ0 0ᾒ0S.S `0S.SQ *d0 00  Q:Q 0S x0 0G: 0 0  G 0S00 t0 0G0S.S `0S.SaA"00    K 00 y0 pc q00 m0 DWpܷ  h DJ   (  @ T |   -LP`pM\   @T0  @  @@P -L0CpPMSHHHHTll 0 ^P`  0 SP` 0S0S/$@K00$O. P Z ( 3P (  0 0, e, ( PO.l N.T PH 00@O>$ 0O.     -QL0M @T 0发0 0-L@80P1PU020UQ 0 R0 Q0 -L(pK@- PM'`8 4 0  ;P9 T , U>0 ,PY`0 ,P0 08 04)V. =t 0K  0WP\+-H 0 `0@`400   < -L0ShX -L@84 1R`N P20;UVp. AT 0 Q @TZ P@ ![> 0 Am̐T Z.| \Z>h 0m-LD oP` D _841` 0 m驐\ |  -L0Sh雐 -LP`84pW 20TAT 0 Q `@TT V00].1 0 ^.hz p-PL@P`M PZp00CS0 0S$0S0S0  0S00p X;00p  $  -L`pM, 8Z  QU @  TPX  Č, 841   -L` HK]zf.   _ 8- w-  r -L(KgNMP.p@ t0@,@T `V  0 PP @ E鈵   -Lp`M@8 ^10S,0  P0P 0,  AT 0 0 ` 0 @PPT0  R0  -LP,Mp8Ę\<0 "841P @T` <00p 0 0 0@P`TV1A0S \<  0p P`(1$m.40 0 8` ,` P1 8 m>8K 08Km> 08@ p4@ 0@ ,@ Pn.8 040  80@8^n.@ n>( 0ln. vȹ 7 9  -L`PMp,ß8Ĝ\  1@T$ K ]@T 䒟 0 qΠ0KR 0@T00pKPq>"0hP@x;q>\" 0 s0 0 0 m]0S 0 R 0000S 0 R 000p0St0 `0Sd0 0SO 0 RK 0   0 0R`* P4%*40.SP P*P0.S U:@`@ 4k]400 .SP`:0 S.R00 00c0@( K0-0KQ@ Tu.x 0 R 49]00   p Rȹ   0-LM @ PU0 P@@ @0 -L`p@PM E \ 0 PPP   -Lp`PM @8\10S,0  , AT  0  @TY p-L@P`M80Qp1P0# 0S@ 0 Q 0S@Pp =`  0ph{.H =4 0{.  Pp 841 -LpM`@8 ^1P @TP  0p 0 0`@PPT 0-L80P01P0 0SP0 0 ^ 0SP0+ $ @H+  q@0 80P1PP  0 \P84. y -Lp`MP @8 ^1P @T   0 `P @T -L P`,Mp  0@@g.<K < P><` p@,P > 0x!<00SN0S 0S .4<K !'P<L0S.<K .L F<0S L5 \P@ <L8PK"͠ 0  @8 4 0 , [0 R40< <0  "- (<.<K  H  t -LPpLKD@K.`4MƂP $ L H D @ < 8 4 0 , (  L40:@1[D2K -[Tl80,8lĠ#, , 0H @9 -,QLP M  t,㊋4pK0`N 40 P` )8z( U 4@*p4p0Sz  @404.Z4 DZ0c( #4(c4"4#T010SV40DpP 40p4p@@.Z,K 0P Z410S74o 1 R  4 A 4 \00D A4DGP 4 A 4 |\x0D 0l(40K4W W`n  , d P 8 Ԋ     -L`pFTHM@ہPPK ;PKT<`K:K 00 PZ0(0KT b"b$ $"TKd 0` T d K\ X \\0`(@K:@K9@K8@K7@K6@K5@K4@K3@K2@K1@K0@K/@K.@K-@K,@K+@K*@K)@K  -/QLP@Ml80, 8lĠ#,?\0S0 aV hzxp0S  0PE0, 0P 8   #8 h^H L < l @   -LpdM ` PP- V >K< Y0,0K@ dKh@ Y PKT@ Y PT@Td$0EĠdD?KlK!D$| D| K0l@ x @PKt pp ́0S   Y  0`>`K=`K<`K;`K:`K9`K8`K7`K6`K5`K4`K3`K2`K1`K0`K/`K.`K-`K,`K  CQ-Xn80.H 8n#.? ^0S( 0 \؉H L l <  0-L@PMЀd8 0$8dDFϠR#D$K00 @. \0 -QL@M 尉`80 8`# h  0-L PMP@0  K9 0"WPdp {WPD@$ 0x   $ < X t  -L@ MT0XQ\A, \(00D |8 Ԋ   -L@\0M 0R\0 , \(00D [8 Ԋ   p-L0@M 0 'X KWP 8S P專X K'WPX$ K WPw$.d巅P`k 0l0h0( K 1X0 VP(0 S- a,` 0K!04c4#888#8D0! XVPd1 Rp Al@\<1 0D(pZQ0S` 00K,0 -hP `X 3X0 00 00 0080 00  0 00p-dd)\&T#y"(ol@e   đ 8 Ԋ  0 L H t     -L@MXԩX00Q X0, \(00D ~8 Ԋ  ( -Lp@DUMh d HK P`D\ 0W 0`PE Y/K 0  0@4 P8$ČȌQ @X P  Q % 00P R P `wQ0`V @!Q000 X`V 00BQPppppppppp( , 4 @ H T ` l  N |            <  L   |   (  7 7 4 @ H P ` l x          0-LA^KPE@+M 姁0 -L P` M@T,  P@T`P+ ~Pp @TP P`TP 0,pA.  ~ۀ\  -LP`Mp U  *| 00  PU:U+ P U&*08 ,K (U@ 0 0T ,KP> T` 0 1` U:B. }P0  "@@rP000@ 00 0 0C.P 0 }  Ԋ 8 \ -L`PMO@Op@OT(@NT /YP 0S OOP  P m OPOW@N@V 0S ZOP@ 0-P@L nT0 i@T0 -LBKI @*pKAMM`$V0 , 8$ 00PS889T9L9T9T9d9t95`044 T 0S5@18OP:,$8$ P 0S5@15sOP:U 0S5@10S:0SS SSS]OP *0S5@1EQO@00CS񟗒\6h8h8h8X8h8h8h8h8h8h8`8h8h8p8x80S8OP *0S5@1 ,O@$0S 0S5@10S^ , 0SL:44S 0S5@1OP9:0$0V `Vo T( ,x|,$0R``S:0304 3P 4NP: R.0305@10V0  N@ *O N@N@$O0, S@ R"0305@1 R"0305@1@QPK@ ("(b$"((("( 0Kl  hDPK c0@Ġ@ =K>@KN000頷 -^  -L`MP $@0 b$"((("xW 0R{~"0Ÿ00 0!AP4 0 0c4#888#T 08#8c4#8808#8S0  a!!T v~ 8  MZ@ 0@ A8,  q0TT@@ $B40 40 4c4#888#8h 0C0xa0TPPNBP H~0,1G 0Q1 , < *0Q < 0R,0~l~P0R@@c@ BP@ \}|000T|`P0P@U@LBPG D}00 00>\ \9 x d9 h9  l9   p9 $ `9 L  -LP`@,KM1 ČL4 0` ,` -0K/@K.K(` $` L NP@L4pK 04 P六P=L?P* 0uP&Fp0S0K gP8}6}4}2}0}|0 QP\|ZM0*S D|<|4|꠷ \      L x    ( -L@M}D0 R1 c1DQQ3@ @T d_>1 Z0@T  00cS S@T,wP  t >J>10@TP p0 @/J@TP/00 h 8 -L,pKS@P`M  0S J00CS&K  !K&K%K$K#K"K0 0KKGJ000BJ ?J 0-LP@$K M4JK 0J00000 -LmMF `Jwm.pP@ 0 I00PZ0m\  0fPppmPPVVVĦ @0"w0S6:^ 6'w0 -L@l M6S( m ww -L@M6P6 ) &Q00 \ | PR00C 0 00 0 Sm00m0  0  00000p &cP 6 -L@(qP` Q> Q00 #Q3 "Q, Q00 -Q Q00 q00 0 P`   0P`DP`P`\N0S 9 p-LP@`M0S 0S0000  U00V 00p00 p-LP@`M\ U00V 00p 0 s\ 0 00 0 -L@Mp P -LP@`M pu VL CX3 00@ S2-a0@S2WpCA0@S27pC`V0`p]>P 0U]> 0U A0  P0w+]^ P p+`0pC00@ S1W0p` _+\P` "P 0nP! 0P3PbP 0 000p@`tP rP 0xPp 0 0,+   , -AoLPp`@xP000pP6 000D_P-P  Bo`]> 0@T]> 0T 0  @t*]N @P000DBoP00 Dp 6 0C6 D -LPB@-BϠ]P` %-P_P` 00  00 @D pT]> 0T  0 0@h0*]N @p 6 0C6 L -@Lp 00 $(B(- BMRQVWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWX0Z8\t^ ``@aaWcTcdi`k4lWmpls,tuuWuLv0S- PD 5P, 5P @5P 5P_5P_5PS 5PQ |5PM u5PO ln5Pr Tg5PO <`5PU $Y5PY R5Pk K5Pa D5P >5P@65P  05P  )5P h"5Pe T5P  @5PN (5P 5PU 5PZ 4Pa 4Ps 4P4P4Pm |4Pf d4Pa P4Pe 84P 4PC 4P 4P 4P  4P#@4PJ 4PR p4P% \4P D4P ,}4Pc v4P& o4P^ i4PPa4Pg [4P T4P  M4P pF4P X?4P D94PN 034P ,4P  F4P 0SN 4PFd 44P0SY  )4P 0SG @p3P \3P H3Pi 43Pi  4P-3P  0Sq>0 04xS: P3Pc 3PA 3PC x 3P @`3PV L3PV83P 3Pq 3PP3PU 3PW 3Pf {3PM u3P@|l3P de3P  L^3P  4W3P^ P3Pm I3Pq B3P[ ;3P@43PE -3PI &3PI@p3Pj X3P  D3Pe , 3P  3PR 2PF@2P 2Pa 2P 2P 2Pb l2P  T2P <2P 2PU 2Pj 2P @2P 2Pr@2PC 2P p2Pg X2PZ ~2Pq $w2Ps q2P` 2P 0Ss P^2PF W2P] Q2P] J2Pj l c2P @T<2PS @62PSH, P2P@)2PN "2POk p t a T    \     _          ( 0 XM 8 < D H X ` h p x  " ( C  $=  ! ! ! ,! 8! @! H! T! p l N ," \! h! T t! |! ! ! ! ! ! ! ! ! ,! ! ! ! ! dv ! ! " " @ " " 0" - <" v D" H" P" `" l" t" x" |" " " " "  " " T" " " " " " " " 8R  # # # $# ,# 4# 8# <# D# H# ! \# d# Pl# p# x# |# # # # # # # # # І # # # $ $ $ $$ ,$ 4$ <$ D$ L$ T$ \$ 8 d$ l$ t$ |$ $ $ $ $ $ $  $ $ $ $ $ $ $ T % % |% % ,% ' X! 0% 8% M @% H% PH P% X% `% h% t% \% % % % % `$ & % % % % % % & P & & (& ,& 4& <& # )1PV "1PY 1P[ ,1Pk]@H 1P] `1P  x0PE 0Pg 0P 0P_ 0Pk 0P 0Pm 0Pm 80Pn L0Pn 0Pn 0Pn 0P  x0P  0P@0P 0PS 0Pf $0P <}0PA Pw0PI hp0PZ |j0PjPb0PQ [0P T0PW M0PZ F0P[ @0P  Z0P 0S[ L/0P] `(0P x!0P^ 0P 0Pe 0Pr@0P /P /P^ /P ,/P& @/P T/PJ l/PK /PK /PK /P /P /P /PO /PR (/P @/Pf X/Po l/P /P /P  z/P& s/PPk/P d/Pr ]/Po 0V/P HO/Pb \I/Pc pC/P P@ VP W$004 l  k  n' ' @' -Lp`,KM A?P@0\\ P@\\\#],G>D kPP,G ,-up5> 0f.\ . .\ Z   kPP 0 @0dY.00dW A>@` [>T kD kT.00dVp Zn Un' \' ' -L0P,`Kp M 00 4 A?0PP@A/? 0PP.A?0T }T{T , 00 ;T @(`K 4 K.0@@P @KϠ4 0p7P@ 4PPl.!k.P kX 0K P I/ +000' ' -0L @ M0.0@P -LP$K`M sIP[ TA?0PM \$ K<PL,$p (p ~;P00 :0@( K@eP0@0 ( 0Sa/jD  ;;P ; '(0[00h=( 0STc/j b=00^?0P00' ' ' ( x 0-L@P KMA/ \ 0 D0  0c( #(c4"4#00 ( -L@Q`pM8 0 40 P,KW  4 P@l   ?0P@[ A?0P  BPRLU6 , 0Qv00pWX# ~/ jP8  0 8p0qPg 0@PgX/8 j/$ iT8l,j<.iP@ ,RᚼlnZg00S }P{Pp\;T  P@0Sp  q/iP8 hle' @( `( |( ( ( ( -LP@M -RTp`0Qo @`QWA@Q7A/Q0A^QU0S%X0 F F02 C U T? T6 l1Xhh! 0X V V0e0 0 m Ve m:e m :V VP   V m9! m90 X t0x X|0 l@ XxP@ <0 0@ ( Ԋ D& d& & & & -LP,pK Mg?0P@ Ao`P ;Tv,  {P@,v> 0Pv@  Hi/P@ `P@l,00C 00 Q/P@< H P@,ͽ4  <P@,8  0:P@  &P@ ,嫽 :P@ P@,嚽 ,P@6 -P E0H!!!?!C!cB0 RA00S !04 0008 012c12c10 C @4 008 012c12c10 C @ ,U@P ) ,) D) p) ) ) ) ) * -L`,K A$M8 <  PP@ AP00pPPPU ;T ,{:|5.gP@ ,@c .PD2@ @00 , T 00Ϡ004K4 Ÿ, m40S < R00/@ g480S) ߴ,0@ S4  /@g,8:/h gP@ ,4@00 0 00,  j, @0R @00 + !   PP@P00P^ ;T|0Ϡ0K00 D@ P@D@ (Q00 ዸ00S 0Ϡ0 \i/x fP@ p !90/08 0f@XiPiHi+ ' 0 Pl`< (+ P+ x+ + -L`@pKM 6A?0PP` 4 0屻   =P a?0Pg {P_ b?0PY a?0P Da?0P   YV X Y  ZP   {P00 S` Z a?0P bP  a?0Ph  A?0P<1P P 0SBbU ( K0YCP  VUn (0K a00B`P,PV }P xPp= ZV6Z 0[ESVN.Z4 ePp! Ze00 K8V P V0a A P  ONp0 @P04Ÿ@7h;87#Y R L2t\H"H $ N$\ Pm0SLln RSsi PfdcPE b?0P b?0PtV! QIO?0P ?0Pd  A?0PPA/? 0PP 7P(0K E00BPK7P.X괠   ZP(x `+ + + , , ,, P, |, , , , ' , - & 8- ' @- `- |- - - - LPp,KM< 0K4 `8 @  w0R. dP@ 0````0 , 7U00@ <@ P|B?@A/=PS A?+PP0 P00/P@@T40!S> 04 "PPz <@TP; 0S`4 @ 1=Q  R A ]?#?0Z\0cT=Q @  ^8 @Q#8 J S ꌗh4T4080!"8  `0 RP@T 80S400<@T PW. ^dU@4 0S 8K0!!04 080 8 X 40U.m84PPgG' - Ȗ - . <. \. -Lp0KPMp `K0  A?@0CZ.S㨀K QW㨀K= 0 pP 0:S @[>,! 0QP  0P 0P 6@ 6-cT@ Pfc@T【  60p@@ fTE1P@Y. cT@ ' . . . -Lp`P@0 P0@P -LP,`Kp,M , P@` Q?0P M?0P AP J?0Pi ?Q A?0TTA/? 0TT?B?DS00~.l P. 00  0P0S00 . ΦP@ .0 0度$eΟ}0 0DK, PD 噴D0S  D0 k 04 K40 0PD0   0 s04 K40 0PD0 NP6 N?0Pl ^ }:P@ 04 K40 0PD0   EY-D i.eP 00 |e *08K 80 WP -| IP 08  a` _eU?0P +Q?0P Q?0P  04 K40 @0PD0  v 04 K40 .0PD0  dU?0P U?0P PU 4b.P 00 e  A?0P@ 4<`*0K,00` 9|P@ b0, Pa.@ ⺱P 00  o( d  /qP amPJ fP >0Py k _ b =0P? =0P_ Q MB?@S@@, *r.  mP @00,&4r. a @ 0S , TP@t00r. uld@hdf q?@0 T B?@S@, 0j. *P X@000,3j. Xa @ 0S , (P@, =P 7'X  0 P0S00 , 4P@,0 H  )P@B?@, Si,3- aP@\ 000,tX@ H@ ,P@ )P Xvm.0 0 x{P@n.@<K <@ 5P' <.0n.0 忮P <H0  0 (P0S K}P@d XcPcc@?,00-|c@Bxc. 'Y'00  0r?0P hq?0P rP @`Kz.p @p PP @@y@0P $00{.n)2@00 S.R {.t C`P@ @0.00{.p @0(@`@@!P @ʧP@ `@0 @- - 2 b?0P8 ?0P -` ïP& 00  0P0S00 tu. h~P@u.0 b gv. ⎯PR 00 Y(P@ t?0P 0. ?0P0 ) P 0$ ?0P 0 0  P@" *)P@ q ";P@k h 0 0  ,P@YWb NP S ' . . / 4/ X/ x/ / / / / / < 0 $0 <0 T0 l0 0 0 0 0 0 1 $1 81 P1 p1 1 & 1 1 1 ' 1  s.( P( 00  0P0S00 s. P0-0 幢at -L @,KM<  8 {P @<  >0P vP  < <0S  {}P z8  0S]80. PR 8  P  a0pK` 0` 4KR!=Q0L"5 \' 4` 9!- $ 4K MP !- !-  2,P ;P 0sa>!00 .x t \^aTr?0P   &A?0P# }PP , 80,>0P U . c^Pe,   P8 0S 80.8 `P 8 P`4a,2 , ' ,2 xD2 d2 2 P<2 2 -L8K.p` M 8p y/PI_Pn804, 0. ~PW] 8 <K/.@ ]8 0S <D_8 8_' 2 , 2 2 ( 3 3 03 L3 <h3 3 -Lp.@ `M 廬P} 00$PK f?0Pm f? \0P  00L 0 sS?0P ;P {P tlX00. Hn 0*P0S  K}0P0PppW. O 9}P 8$.0 0-%-0  ?P0 P  00 00 00Y_~' 3 3 3 X/ -L`.@ P M(P^ 0$K0 (P \00&-4 p  0pp P0S )P {P0 .0S00 Pp0S  }PP. ⭟^' 3 4 3 3 X/ -L@`'-p M岫PP- 0 PP 0S$K 0Sxp0Wl  m00W.8p \0:S $ Z^' X/ $4 < @4 & -Lp.P `MmP 0@(K@  Z(P  P@0S | ,500\#X  )P 0 ,0 0   {P 00.   0P0S p }0P0P@@TX.  }P 8.0  VP V?0P 00   eP@0S .   U?0P- {P D.0 |  0UP@)-  u}P ua)-0 Z e P@0S .< .DW  L$]' H4 T0 3 3 h4 4 4 4 -L0`@PMu P 刽Pp00)S -S0 (0.0 峼4 ' -L0Pp@ML P vP` 00)S -S 004 -L0Pp@M) P P` 00)S -S 005 -L0Pp@M P P` 00)S -S 0005 -Lp,K 4M @ePP N?0P A?0P <0P  (P <0P B?ES0@0 @ |,f,, YP@n ,M  (PP @.-P @)000\ U. PG 0@-  `0 @. PX7 , 0``xPU   0 @-,PP )P D*.00 峻@` 0S . ⧻@P 00S\hP\ M\  . P 0<\ `0 ``%P@ 0S @@ 00VD  )PPm 00AP A?0P6<K @̟,< 0PfPOl [L.H oP AU 0 00 00 K@00 0@T0.0 0@@ h [  6- CP *0$ [G?0P ~BPd >0P c.$ 'PR 00  U(PP . O0@0 j NP&  <,PP  .x ɺ 9P  'P)U &.0 0屺0S .- 000t S[:- ʥP 00JP@.t g ;[>0P J?0P]0  00 . ⣥P 00 t [>0PD00  . ∥P +0Z8 [TT  :-X tP @00,0CZWo`P 0>0P NO?0PH >0P .NP7 00  |(PP& ]Pd.0Shm Y00  _,PP$ cP;  Q,PP|Z0aUP :U?0P"` : , P 0 ` -(PP  &A?0PPPA/? 0PPA?0U  . ⤹,@哬  ,PP  A?0PPPA/? 0PP:A?0U,@s  ,PP Pe  ,PP PW "V  ,PP P0S A?0P ,9P 0 0,0P  0 ,)P 0 ,"P 0 h,P 0 , L rA?0Pv , P 00q,P 0 ,P 0 , tY0 `  \A?0PP4,3PU ,P PUK @P gU , P 0P,Y 0  ,(PP.@ Ph  P@0S ,  00  ,PP  00.  A?0PP  .0 ,sP( "P ,lx  00. 00  )PPj  .0 P 004Y .` vP 00  (PPN P' XX' X5 $0 / t5 5 p1 1 5 P 5 5 5 5 6 (6 6 <6 X6 1 x6 6 1 6 6 6 6 7 7 <7 X7 \7  d7 |7 7 7 7 7 7 7 ' 8 c?0P a>0PL _?0P  XT3 .` P) 00 0P@ 0S 0.,? +0卸P@0\01 . oX A  =PP%`  . ӢP 0OX>0P wc?0Pq  (PP9- ⲢP^  P@  9-0 I  ,PP  .0  A?0PP  .0 ,?P% P ,8X  00.( 00  )PP6  . P 0 0W  6-FP 0W q. 5P 00  c(PP  gP  U,PP  6P W C/-PL 00  6(PP P  (,PP 0S4`K P.,U h040 סP 4@> 0%. ┶>4%0.㊶=W:WT!  --  ⫡P @00 0 K0 0@Ts00-- AW$`0m?0P %g?0P ce?0PN be?0P e?0P& . mPK  (PPH4@K>\' 04 400 t0S8`K  P1-,U 080 BP 41=08' \1- 1=8( 0Q1-, V1-L /XVgP g?0P  I. P 0V 8PgU  #`"`0(PP  )A?0PPdlD,PP)9"V0D0 &2-d ySP@ D2- ϠPw 0@-  2- 0 @H0 Pf H0 ,00PZ  ,PPH0 0. @, L0 妠PE L0 P P_  ,PPL0 0. @ P0 勠P' P0 P PD "V  ,PPvP0 `. @  oP P PpD UP U\ U Ut U U DUv,P Pa , PP[ ,PPU ,PPO , (nZ  d., (P 0H UP W>0P >0P G  C(PP  0Pk 3- ⳟP5  (PP040 4 00 @T  .,PP 4 ⑟P 40 4 U0S . NT0#`l  .  kP !0=<To?0P n?0P nP n?0P;00oP60 309040=0P9 o?0P  P  o. 3P '0T80{P %>0P  U6-@ P 70$T?0P0]0[ <  8(PP  1B?@SP, . P @(00, $. dQ 0S ,D[T ,WT70#:0! . ƞP6 00  (PP Pw  ,PP Pi  ,PP P[  ,PPsT' 8 / / -L`M@T, < 0 p >&,K0╞. :0K 0P^ 4K  -PS (&P" !P %P P,\U00< 0 00  ,0 p0 {WZUC  rW8@K*@2 8@ 1P 80 K 0U 0@ , 8@ p<  pSsP0080 8@K0 咴0 0K0 PP P0 S 4:00*< P <0,00p<0 00 0jS0I@,FTP Td0G3S񟗖,||,TT_ TT\ .0K b00TLx.L0K TT? H.0K $0K.<.,K 0̳3P  =P0彳&P00y,0S.P,K *P +P0壳/P0埳1P0図4P^P# /P =P0吳P0匳2PS?0P |P0偳5PS?0P0y P0uP0q6P0m0P,0S 0S .(,K 8400' $8 P8 l8 8 8 8 8 9 89 -L@,KM  `p8 0 2;P =P8 0 ARPP^ 0^ 0aSN8  ^ 0AS0 80 8 0aSPR  a\00A\0`S8 K0Ko\Q8  0S0aSAS  ,P; 8 AR 0S aR8  0aSAS P AB- ; P 0`0V0B͠?  0nP 0`V C-0K0 1$QQ  80 0< 0` ;B-\<K" 80oS<`< 0` <0S8 <0SB- 0q c0K4 KHP40S0\H  P' T9 p9 9 -LP`4ML B B@2R$lllllllPlPllllx0|lllllllllll$lllllllPllllllxDpK %A?0PP@A/? 0PP 0 oR HK @hǟLKCD#H 0P葡PD< LZ  ڡP F-' `F= &&0⮛ Q. P@D DpK A?@0CS@ A?0P 0 oRtt& HK @<ƟLKC=DH 0PFPDLKC-3 NP LPL0@0C-6 uaT LK aP @KP 0LKE͠DE<K@  .uP@- DK FA?0PP@ ?A/0P00 PppW AhD P @xğLK: 0Plhh$wDpK 8P@% A?0T 0 oR $ ;T ,PK D 0LKEM$@ 0P@ ,PKLK`EM@DpK A?0P@ ,PKD 0@LKŸE: 0;@PD D H @ŸLK DH 0P`PODK A?0PP@ ?A/0P00 PppW 00oS 00oS{D P 0,0K w@LKF,KD P D P,pKD P D P0 00oSpeDpK p@8 HDpK fA?0P@/ ,PK9D 0LKEM/@ 8DpK GA?0P@ PA/? 0PP0 oRl"HK T+ ' 89 9 9 : : ,: <: P: , d: :  : : : |7 -LC.K` Bp BCMMT Dd ,PXd  P0SM AASI B0C2S9000000000000@0000,000000000000 00000000000@.PPW BKAA+fB`L 0S K @ ,P00ARPPU@;P TkX K@@I=@$$00PT EP" Pp BKAA I-T6 P TP4  `0XNNPN#DCNK@D@DP @4L4 L$0 S(0K @@eL4`#(.CPP"  K@ A?0PP@ڗ?0P P hH$P 0L4 th K@ P@H$,K0,K ;T K@ A?0PP@$ڗ?0P00 PXHS P HN P0,0KHF P,KtH? P d` K@ P@,K0 H$c,K0INr K@ P@,K0H$M,K0KA A~A?0P@L$00 SL(K @ @HL4`0X4 Pk& ' : ; 0; <: X; p; ; P: ,: : ,  : + ; |7 -L@ PK`pM hA?@0CS00$0  ;A/L BR0!$ $\ $ H:\ :P ` $dLA?0P<$K $0 R :; ; ; < --LQ~K pG`NK M MN @D0!Pp 00S  0NU*KU 01@P0 SG  0S 0NR:@A0K01L $ 0PS(1 R06 n n n n0PS nGK nG/K\U @K 0PUC0<<  L< P< -0L*KIMM:  jV4 )}KpG pGPˠ AN@  0@ PV p P@q@6S;@mX P $P6S 4S `d 400 0 d`V$ 0P`"@K 4S0 b~K0*=K0CpG$ ˠ$0Cd  P@1>K0C 0C` : *]KPEPEq $* J 冐P@@ /PP0 T %[8*<P00R00S@KL X 4Y ;0DSb:S* K@>* K@<*MK@D @D̠*?K @ @*KL LK*: L@# @ዐA@B YP@ B.  DDDP -@TLPp` @T -`VLp'@P"0@@0@@0@@0@ @0@`@0@@0@@0@@500@P~V - LQ`AM M0$ 8$ 4$ <$  d000d5 1p p84000`1111P> `@ 8`_P4t PD@H8 \Q!* R R00 R0SX 8$ P\ Q: P P P P 0S S S S000PBKJF  ᕕP5 (4[;S #S   P "4[ S S44SP R R R00RppW`@ u_qLPp8t 8  PT"4[ S SP4Q S SP \ \ \00\@@T`p J _APP@HDp`P \ Q!* \00 \PXP\ Q: P P P 0S S S0 8$ 00r $P'4[ S S#0Q S S P \ \ \ \Y BKAAQPR 0$ 0$ 5000,$ 0 D  Pk 4[ S Sg<4 SB^K6 \ \ \ \ 0 SS* ;Sp' 0 S P  ;Q 2  0 BNK@D0@D0 P<4 S<,4p@ h1Pp \;\ 0 0 P 00 P@4 ,4l1 <$ <$ @@hlhl`  P!4[ S S4!O0Qd1 0 < 2d1`0S 8$R`0D0H -PP 3000BNK@DP.P `E0 0 = @4A0@@ l!@4A0@$< < P < < < < < ,X < < -LP`p@0}0S S S0 S S  P$ⷛPd1d1 00 d1d!00 R R R 0 R R R0Sd<^0 P⌛P00 P P00 P 0  3000 P0:0h P09 L P09,~< < = = = = ,= P= X= `= p= -̠M 048K$0C0C @ $`V$ (0K!4@0T4(K!4S@ ,T  8(V#"H  V 5(,%05 PPg(40$$V,`0@,5  @p>$\ 0S  % R % @48#8c4#88<$8#8C("(0b$"((("(B848#8 c4#888#8C4$( "(0b$"((("(0i B0  0*, **$0 p @u p, %,Q 0T0V00S5  $0  B5 A R4((4444(4H(H H((((((((((BnKK`FJ`F J 0SP ,K∎P ,a80!8a#! .<0..4 0p,@, 0a0C8#,#80 QBnKK`FJ`F J 0$PP ,KXP , b80"8b$#".<0.(.4 0 0p,L, Pt P@o (0K@,@, @T$C0ZQ.K0 BCK0SCK ( K^R  ^P*$Q0S $A^P1KPAA ,5p0e,5 BnKK`FJ`F J 0P,%+ (05PP,e, !prBnKK`FJ@`F J 0, 0`0CP@P ,5 PTpRBnKK`FJ`F J 0P, U0e0CU,5 Pp0W3BnKK`FJ@`F J 0_\@,%05 (jPP,e, pT 0Se@,   010Q (Q05 PP@ P@ ,0  Ġ T0pU 5 0Q )Q BnKK`FJ`F J 0*PPrP,%0`m0C ,5 ?DBnKLK`F@D`F @D 0PPWP00P0SP , 0`0C,5 p 0PUPU;P,0eKJ J VPP.BnK8`F#,`F#8 0 0,%P Bp,% KJ J 7PP8#, BnK#8`F,A, @0`Fp 0\@,%05 (PP,e, pT:KJ J PP8#,#8 0p,% B,% PP8#,#8 0p,50C,5 PPBnK8`F#,`F#8 0 0?,PL, p  | 0 R R/  %,0S@@#0 0BS,<@ 0,0 %0@,0 ,0S 0@,0 = @-P`@^0tpC 010\0S 0 T  0T0^T0* -L`pPM \0 , @4 d10c80 Q 0(U00S 81  00 0 \ U00gX"Q/ \Q& Z 00A S , 00CU*0040A0@8 @S40 @00ST0  0 Z@04@  Z0 0 "0 < @-P@`^p0 00! \ R V00^;\   100PC`)\00S0N0^0S0 \V -L@@`MpEPU ]0S0 0`p 0P -L@MPhCB p-L`M⯓˓PU% P@! / ,0S  P 08#8c4#88L 8#8RD@0@ Pph鑓 $: p-LM<`PU @   TP00p$: 0-LkkPU | P@ P< 0 Q0 @@ 0hk(: p-LM4`PU @  TP00p(: p-L`PM@T  P @Tl KQiP  pPp0T  000S 0@ @ph 0-L@ P0S 0h?$: 0-L@ P0S 0h}(: -L` Mp@` T X 08#U @T P0T  000S 0@ @0 8 #8c4#888 #80 $: 9 @-xQ0 h@\ QQ  000S 0 00(: : -L@M@0 R 0S$ } (: : h 0-L HPX0 R `  r0S$ 0\ 0$: : h -LPCKL`BM M`@ `<4 0 B~K8 pG4 pG  0 BP@ BKIˠI 0 pP@ <0 `   08P8 8P84@$0`! 0P@V   0P8  P@ 84S   08 -L`MP6Pp  0 paP`@TU w \ 0  paP`@TU -L`Pp @T U `PEp@T -LB^KPEPE+MM@x  |:  Pb>K0C0C: eK⦞KHI,$[@H I.R4 x  0Pt:Spt bt:PUnK`F`F 0X PPp6#8'SS S t:U0 0S@ .S \S 0.S0.S 0Sl68#Zp*[0RPPW W4P ?P S0P| > X`&0KPx |: b;e.K "(8#8pt* St: pt pӎ* -L"K%^K0`MKp@PY\0  4 -Lp M@T QoK 0P U@KK@@/0S   0P0  0S -L₀ P`MM  đD H8  ~KpGpG  0 P@@4#8S 0  `$V<4 8#R@[P H(PL @[Q P 0 D-P@ d P! B>K0Cˠ0C0$P8 PPP 0S@ @0 0000 L -Lp @AM M P CnK`F`F 0 P<0#8S 0  P$U80 8#R<4[S P008#8S@4  P  @$,D k 0DS 00000 -L@MQ Q p-L@`M R PQ00000S PP.  R)  R00000 S 0 00ph  0-LP@T JP0 @T0 -Lc^KPEcMM@ KPE 0@` pP P@@&0PP@@Q   P 0#TP@F cnK`F`F  0PG @P828#Y@ 0"U@6 R@60<2#8'SS -L@PplMI 3  P`| , ( Py   l@ PP   =ȗH)0@)MPp |0@pKlK hK Pp p00 0PPCl  R00  0tK/ 000|0 tK 0PU 0'@xK $H@PP@tKPUPP | 00@0|0  0l  00%  #      4> -L` ,KM @^ ,0+P[#x0S ^0 4S 0$4( (0R -Lp PAMM0 40 4 c4#888#hV`F#BKHHˠ 0  0PS P Rz @w 4$0T S0P 0S`FP -L` PM M04 ` U x> 00$S:010S7 0 4c4#888#8WSpG%BKIIˠ 0 5 0PS P R# @ 0 0 PrP0pG S010S -LpM \ '2 "   10 R0 P2 "   P@8@K^ R  \ ‡ ^ 0Q "202 KP0>\ @ KoK_K⣟K @2 P<>F<@"RB a0V2 1#V10# F >P8 P ʀ00 P101J@K P2 HK@0 H@ < DP y_20PR0 J0KI KL "(P@PL0#8dC$ȰI KJ0KTڤK 0P@4C4I0KI0KJKJK L "8 SR"(. P@PL0#8dC$I KJ0KL ([*  0Q V \ L^Q "  00TX 20lC$I KJ0KL0 #8   _K S@1L# sP@L0#8`C$I KJ0KL0#8SK0 8Sx Q 10#0\0S \P@K 2@" P@>@@@)TU "0 "0  " y ) RK@0. Q00S " g F )K0  [ )KP0 Ό Pt )8@K0).K2 mP-Pa1a011S!  "P4 P101 0S 00#  P1010"k2PaVl3 Vʸ0^ JH0P৯KPlR 2hR ( KdR A`R \R XR `TR KPR  ᜂ 0PDΌDP@b  0S2Ya ` P*K08@K @?P Pb <ڪ/K0 8S a  )   "K@ 0`P 00SS S  0  e`1S"2 ~P    n0/K0," a 0 2 oK3@/KlTPOaHU 101j 000"@@2P4 "xR T (! )TZ H -L@M1S1 01!p@-` 0R p 0$4R@P0  4$8Q -Q00PLX`pM@P R]*0#8Z 08@#8c4#888#8(K :PPI0( #8@c4#888#8 )PP80( 8@#8c4#888#8 PP&0( #8@c4#888#80C PP(0p0P( @0S* 04S -L1M M@ D, H< 5E@ PX' @0ptPh BKIIk 0` ` 0SPV0 4SR0 $nQ?NK@D@D 0L `gPP7L,0S408 <400 0$P` T, ! 04`,QX< 0S 04\d P< 0 d $Q\, DQ 0SP,0BS0`#8c4#8888C#(b$"(((DP "(B4\P 0 P ÞKII  0```@EH,QRNK h0D @D @D``/E+  P0D``"E 00 D``E+ L 0 PD``EL 0L 0D ``Dd\,0AD ``D` 0XD`DPQ 0X,S39`X, X 00#8c4#8888#(b$"((("(B4 0 Z00`T S0cS>0S@ h 0#8c4#8888C#(b$"((("(B4 0 P,RP  Q&Ƞ,ȠlĠ,Ȍ Ƞ>K,Ƞ@0CL0CD 6K5KP`DH<D ``DBX PQRX<02D< P 0 B4> p-LP`M @ T 0 S.R= \ 0 S.R* \p\ lP0^.S p PJ0\S R!ZQ Pp Pp \J0\S R!ZQL TJ0\S R!ZQ@D 0-L@P90S0 0P00 -L@`p0SP፺U  0R.S .00P U0R\S PEU  0R.S 0R\S p-LA^KPEPE+@M M nK0`F`F+S  p0SP -LpBM M8 PB8PW  Q00R\ '0SX X e{ 0G@T P 0 S"00000 PX0PK,Ƞ@0CL0CH$.K-KP`B  H$``A00_0!,  0""$P  e4> Ԋ -SLP@`p0PPE W@ @R@ @UTZ0h01 -PLp^ M0 @T 4yP@@4T 0+p@4 0P `@0S`PcV@4 0 @`@ 0 Ĝ  0 `V@U1$KP1P$0P -QL`Pp@ MQ$0Qzu(PU0  $UE(0UeU ,$K0c \P,0$ 0,0(Pˠ, 0 P$ 2,0 0S,A,00@$,0$,V@4,4dd d d  0S' ,00,0,0@$, $  48# 0S,00,0(( 04Q1(0Q1 0 0$,0( (0,  -LTM` WV PPU '0PPP@(A4"ȠA0 @b$"((("Ƞ0x010L$x` XtP @ pG0 #30 00M JXpGxK 0(K oP09@@pc  R00XPPU00@ 0 f  pG(K 0HP@ @h @d@B]@ P X 0W: @@ PL @H@& AY@P E @ -L@MP0.S00MЍ -L0K@M#p0d -L Q`M-*pW! ( V V$*.000 S*W @P 0S T*\00D@`PD@pWpW V V0304i0*(00 V*.00*0Sd ``` R`*\00D` 0d0 8 0 0 00 V`:l? -LPM@, T,` QA\T0 .T V*@0@TP0j@C0 Z *T@ V*0, 0bS 8(0 00j@C Z*@0 R T .R`T V* , 0bS ꈀNP 0h@11Tq BP @0h1Tp 7P 0phW@l? -p`QL *^ 0S*^ d@dP0 0 00  ^^00f(00 -LPR 3 #Y 3R M0 0p,0 0 > @T 0' S Q*0 R0i000 ? 04 3 #Q #R0hZ @T0 R0i00 0  (000, 0S*`V*@0 Pm0  -SL0` M00 , ,0 4 p0  X 0S  0S0 0@ 0`$P"T`@TX 000P p 40U*z0T`,0cX0 00(000P C 0S Z0h* S0p04 Q*@$?-#<0"- 0cp0,0c p-LFOKP0AM-`v 0 p00p -LGOK`p BMPnp 0 b  -L0S * R 0S* RS0 (0 0\0 "@0:P:iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii0!@]PA0@S 00 -RL M, *`0` PU,p 0 S0? 4` PU X:>008(000UU @TPU R0S00j R -L KMa`80 8`#  -L KMR`80 8`#  -L KMC `   -L KM3 `   -a80!L8a#! KM,  -a80!L8a#! KM,  -8L#8Mc4#888#8CĠK K0K -8L#8Mc4#888#8CĠK K0K p-QL`@PMpR R R \01p9PTp`{ -p`L @VT T T @X JXpk00v@TPZ3PMT -L@ M00 @. (/5/MЍ| MЍ MЍ ; -L@ 0 M @ lnpn -L@M0 R'0PPP 0SLS 0<Q .,O ~.L 0 P x? -L@ M0 R'`PQ$P ' $Kp 0b$0S Sp0  i0j d z(p m0}P P x? -L <0 M0\  $z@@aPP x? -LP`M⬡0S0 , I R. ,pK!0P@,0  BRQ0KT! 0P@B00  BR4,0 Q0  "P 00P@  ,0  (0 "0 0 2. 0  0L  0< ( 0 P / 3 x? 0-@PL0 R'00S0S0Py'P0'P0(o'P0}'P0 3 / -LP@`Md P"PP  R81 P/0S  ~/Pp 0J/Pp 0  0.Pp t /0 DP R BϠ0 / x? P 3 p-L@P4M:LßLPp(@ @@@@@ @$,P ß   # 3P@p ß P0(@ @@@@@ @$,PŸ"2P@pŸP,(@ @@@@@ @$,PŸ"2P@pŸP$(@ @@@@@ @$,P`Ÿ```"`2P@pLŸLH`(@ @@@@@ @$`,PŸ"2P@pŸP(@ @@@@@ @$,P!1P@p(@ @@@@@ @$`,P!1oP@p 0 `@@ @@@@@ @(@$`,PYP@p<< @@@@@ @(@$`,P   1 BP@p%"1pp ? \ ? <$X ? 4P pt ? 8h̭` | h ? H?D@Ax TT :`=| ? ns q C s -LpA/ `M@P+P@@ " ^ 00X@`p P@0 0 0 0 0 0$ $0( 004 0 (0, ,00 <08 ? d --LM 0S  0S00S  -P -LM 00S   -L \ 0 0S0\ 0  -L$`KPM&p_?l 0Y-@T (@@ (  0a/@  h-? -L(pKP M'0 > ,-`V ,@@ e00 Kh,`e/VL  7- , 00 $g/`,-g/0K ,? -L(pKP M'0 rj? ,`V ,@e@ k00 KhO,`k/VL  , , 00 G$m/`,m/0K ,? -L(`KP Mp&0 0K0= ,@T ,@#@ mq l0p ,@q/TL  ,, 00 $s/@,s/  T,? -L(`KP Mp&0 0Kv? g,@T ,@@ +0w hp+@w/TL  r,, 00 $y/@g,y/  ,? -L \ 0 0S0 \ 0  -L$`KpPM&< 0,P@ (@@  0S  0S0 \@/$ ,(  0 @? -L 0S  0S00S  -L 0S    -RL`PpM' 0 R0@T XdP0D 0  P*P@0Tt @ 0-L@P0 R !P 0R! 0 p-LP@M `R !wP 0S  !p p-L@ PM00CS `R ! XP 0S  !p p-L@ PM00CS `R ! P 0S  !p -L@`p `+PP 0,+PU Z  0 *PU f+ -L@`M 2+PP 0*PU Y0  N*PU  9+0   -L@`pM *PP 0*P0U   *PU  +MЍ -L@`pM *PP 0*PU Z0  )PU * -L`Pp *P@ 0m*P@Z 0 )P@ 0 'P@ * -L@`pM n*PP 0:*PU Z0  )PU s*0S C0 R' 0S 0c( #(c4"4#0  0-LPMP 0 #@@S @x x0x#t@@V @` `0`#\@@Y H0HH #D00@ 4@ @@  L@ 0X@ $ -L0 M(0 $0 !P9 $K( K%P[$!qQ00W0STWpS`P0050PP@P PPPPPPPPPP0P(!`IV p (}'0(0 !P  d'P@ 0`V 1 ` 0VH0 <0D" (U'#** d@ @ @ @ -L@p`0MD0 < 8 w!PF 08K< K=%P980S+<@K @l80,8lĠ< #T,#'a!Pe8 @K0%8e4 DK#.@, 4 K0@ (@ ` $p 0@ !d>*x=00 <D&<3*m=00D0 ߬P @ @ @ -L0`p$K M( K(0 $0 $Pe$0S[(P,K @,l80,8lĠ#,\, P@DFT=V 0 oVP@D hV0 @D0P T  [A/(& )=00,(p& l)=00 =00@)=00 ()=0 0 @ |. A @ @ p-RL`P@,M< % <0KU80 4 T0 $ 0 , (0  K1P `\ JϠT08 K'!p, ( 0 $ 0c( #(c4"4#<0 ,: @ -L@P` MpY 0S 0 -@S P  Y p-LP@`M7 0S  @2 0S p wJ p-L@P`M 0S pphtJ p-L@P`M 0S dpph p-L@P`M0S pphY -L@M0ShHJ -L@M0S $T00 h鉫 -L`@PMp( 0 S(K 0 #L0 0bP 00( R  pI p-L0`M 0 0 0SK K Z#@T*0S  (p $K. |>%$  @ b80"8b$#d"un_PP$ K@0 f(&fD.D$P$@  ^( d@ 4A @ U(XA Q(xA M(A  -`@VpLPd  0S H  $P0p0,(*(0A A -L@q M $00(B 0- L@PP0S 000$P0 0@d@T000 00 -Lp5`PM @,P  &< U ⛌0p`$0$ $0$ 0 0 L` -LA|@M Q t0  0 `0 048C<0P 8#8@PL| A q0-LP <@ 0P8#8@ PAq0 -LPP`pM,0  R& < 0 G@̠Td \ 0,0 , ` 0 !0p0@ oE'~pLB -PLp`PM R> <0 0@T 0S( ̠S  @T PX0 00  0S <00S    P 0-P -QL`pPM S* < 0@T 0̠U  @T P<0\ 00   P -PLP`M Up*1@T @TP pW:\@-P@#*`p 00 00 $0 (0B 00 $(B( ^\: -L@ M00 @&#` ## -L@ M00 @#h t## -L$pK@`M'@ |PP( P1P@ @F ,!( J0N#PPL 5( O0B#PP4Z- Y  (@"8( 80S[ P a08 &#P(0P1@@\o (0D8c "4d (0 @ @Q hB 0-L@P0 P'0 \ x0 R (0 P0 P0  )0P0PPPU0H0` p -LPp M \ @T 3 R '2 QZ 0SX <`V 0S `V/V 04000x""PV PV, 04"ZPv,K-Pp,Pj8Pd<Q0SPY0@000@POZ@DxPG P@P: R P1P+V 0`K 00 P00 Q/ $Y  0 >P Z $L V?{ q<0S8``V^` p x hB B B -L`PpM6 P"mP d P@ L [P0 @T \ LDIP 46@T $0S| @T:P 0S 00S  PU 5 R ' 0Sz꼤<x<0dSB0S:80S3 0,%P@0 0> PS}/( %P@(40l(0 R 4( P440$'P@((V(8R$KO( $0@<0I(DE R0$00 0 PK\ 0#y$0S$((Q9 0 0 P (40S,pKI(, x0"P@ -X #s (0,(  h(40S ,0( 0S 0040/ "(4 R @0 P@/( {$^',  fP ,pK`" 0, /P@ 00"P@( /  ",!?="P@ 0 0!o P,  0 0c Px(K(\ 0 l0!P@0 0(M Pb0 $0S(, 4(0S).P@(4, 00rP@/, "00S *.0 ! BPD & %0S~ |` B B B B p C hB B B -LP@M(1 Q 0S 0 S '0 RD0S.8 R <0S 0S< i q " /P` l 3>Pp<0<`3.8 Pp ` B hB -T0 Q'<Q 0S Q/? 0` hB -PLp`@\P0ST Q8< R 0S R/R8 'P 0\ 0 ` C -L@pP`M\'~P 8P Ϡ T0XP 0 \ 0 ` C hB -LPp`0 P'(0S8P <0S @T <@ B <0S <0S("` -LH0 R' R 00 S ` ,0 R  @0S  ` @- P@@<@ 0R 0S' 00@h -L0 PK/`M0% pN@?>T 0 $@/Tl0$\ @/T< $0 0+@ 2hB -PL@P`M d1 R 'LP P 00S PU 0 RpK'B. P` 0 @ DB>0 eP` B.  C>X 0RP` d EP`C. h B p hB -L@MH\'P \ h -L@MH\'P \ h 0 P'h -LH0 R' R 00 S h -LPDM\, ',`K- r!P@,p!0VP-@   0JP@ I.U!  0<PI.@t 0S d P@@J.  0J.@ /!` hB C C $C TT -Lp M\, '0 `,KK. !P@,Pb 0T00SU00T00SG&10T00S910T00S+T00Z00ST ,0SN.  "P@00 \P@ " 08@ 0@ 0f@ 0_@h 0X@L 0P@0 0@` hB ,C  (>0ԕ<̕HЕPP - LPb0Sلr P@h"00`"0P00H20SPꈔDDDDTڄ;;S 0 R;1Q/ZtP0@080T00S 0S00@0ES @\1" T0 SH.>000S 0S 0S00@TT0 0 0 T00RPPU >T0 =Zp00h > `00Q bP@<=ԕ̕Hؕ<PPЕP0Q$TQQ -LM10S ʤq0S 100CS=x0Sp1  h!0SC̗̗̗ldlQ0050S0$0K0$ K#K 0 -AP!0DP0U00S \`0 @0T@_0 G0@TP 0Q0000(00S<ե4d=Pԕ(QHL<̕mTQ R -p`L0 WM 4P20P耟00CS)ؠ 0qP@U 0 S 40S40S*0Y R Q 0S s, 5= @00ԕ<̕TTR -LP@ Ḿ0S10S ꈚ8l8U]P[?UVPTha 0 R8@!<00Q R10S 0Q0 <P0U%T#`0 t <0 (K'K忺$ ( KH0`'@P$0D <00ԕ<R̕RЕR S0Sm`S -L~M M0S 1~K(A~,?P6~LKq(@D@DP0` 0P`?Pp!{<0L 0P`?P0!~K(H~,?PPʜ!~,v?P 00`0 0`?PZ` ᑽP  x<0 0 垽 404?Pd0( %<ԕ̕mSSST0S(T -LNK @D@D MM8@PF($< @P:#;s0S30S 30SC0S3; c平P} 崳Px 30St Sr SS|#x z;pl u;ds;`300CSTTl;SLh;NK@e; @D8b;@D0_;,l;0S0Se ,[R: <[SS B6&R1$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$J0S1 B;0S1 4;;lA^K PE:PE:;0S0S 00@t1t@:l1   <[S 0S@ a0 S,:0S AP 00hP00@0@: ,0 dXTtTPؕlT|<ЕTTU8U(dU$UUUV T(VHVhVVVVVWԕ W0WTWtWDW -L$`KPp@MⲒP0$0P) T $$>>T $們}`@ xuD@$>> 0P@WܕWWWW -LP@` Mp ?}P@ 00u~W p-LP@0`M Pg~pW -Lb>K0C0CaM MB"X0BQ 0& @Zl2 ,60bS\",6 0,6 0S#0S 8BZK @, PRK@ŸBNK@D0!*~Z10 0b fZ AZK @a=DBNK@D! 0C~ >L10BKSI`, RK0D@m0 (!})PZK @zApbK @s ,` RK0@K 0 0@L  Pp `@}BKZIL00 0`Y   =(|t$4X,X /DX(ЕXX  -L@Md00m0SD 9 h0P0 90,XX -LMPqQ0HP0 P\Y`Jh1 0BS R0<$ K@P;01 Kb3n&P3&*P"%P*'P&0/SPv  0 0@ j ,9 p /P 4P (00(4 =%$$Xd -LlMPuU0HP0 P0PX50S x5-=P "d%8T50S= .P985 0BS  5 RPK0 @P'4r%PP"iʰD*PeT0S40S KP0S 40S a= d0R \40S T4 \0a= d0R>?%PY&PP-10/SP VS0S30S$ K⠄P0S 30S a= d0R0S X3 \0a= d0R@#Y(0S S  i2 RP P 20S P g00"'8h20S S, 0CSK,/ 0SP@bUb F@,0Sf R0Sb 200CS0 0 ä0 .X00SA0S`tP` 1Q咵b E@k,;,1吠K0 @0SPj 0S (a0S 100CS0 0 ä0 W00U000S 0S l0vP  786P ,00(p ;{/#$$x,XHx`PLXXd -L`@M00Y,0 q+PP0,P00080 IW30S<  -P(Pp30S0,0  c,PP Y Z+P430 SS SC :;P, d0"%7$PP0/S ^P@O Uʘ20S ,P,K+q`r0S SP <},2 $"00080PP[0S A0S 100CS0 0 ä0 W00,K94@K0, D,KPv0S Pq0S <100CS0 0 ä0 V00U(0S40SPa <0S0S}PP7 Z ,K=,K9 +8004P x:@00SX.`$YPdt -LMQ@fPT T 0i%60HP0 Pt0S $+PP10 `V t,P X0S @0S 000CS0 0 ä0 T000P p 8i,q YYYYHx`PYd -LPMa0,P @pDP P00 SFP P<CU010S:  4PA0 $P 0S , K8P P@U00S 3Px @ 0S <Pu@<30 000$Z(8Z`ZZZ -PL@0S 1!0!@!0!ZRPxa 1!0d!1X0LPPP U@T< pP9XLP`00S 3`0S@1p!01P@1SXp00S `g3PEU@@ a`Le` V3ؗ$(Z[ 0-L@0PS000000 ~ Rà~<ʂ;;S <230t0p0 l0 +P2P0H 00<0 0000$0[d[|ĕ( -LM00@S000 R ~ RÔ~<ʂ;;S |<2h0PPL0 0 @0 80 ,0(0[[|ĕ40 ~00ἕ -LM20S 2y"0S10000}Pm࡟ 10 aŸ`0 Ṱ0 P@YX@PPN@T PU+T)Hq8 00R $!$a0 * 1P60 0S0`:`0cZP&0  000 0 00@00 t0d0P@Q \00PP0 422[0ĕ4((,\ p-LPM`0S8 00S20=PP )0/@00 0@P0SPU P1P PP@p(`\4ĕ\0 0b0~ĕ -Lp`0 0@K M  0 0bO TS0`V p00 H1@_0 n0 0 0 K`P>P0 KPU` Y)X'@0 0bPoV UPoV0 V U 0X0Y0Xĕ4 0-L<@<00\0P 0  lఽ0000hĕ Q-LP`p0pp 0 cR\0P U@@ н0Pd0U`0ĕ -QL`pPMp0p 0cP'P0eSU@@ ᦽ0Pd0Up0ĕ -p`LWM(P&0圀 0@cTʈ00P@ ?SP@RP@ -0`V0W0Vĕ -;L0à`KM ` 0S10S  ?Pt10h!0U0T.P1P 0 cR<1P 4?S p`Rp` 4P 0@T_0U0TPƽ00 00  KP \0\ 0u0 00d 0R 08 ?000X,Oĕ\\\ -QL 0a}M p0 <0 ` "0 KἲPD0S0 0Ir!0300U0 0 ;T91堁 0cPP/Q0 P0 K0K P$! 10S000 PJ0 0P000 Z@T_UTV R 0S00St UT 0S X0@ 00R00S 80 0S $/ $]ĕPL] -a=L0apMkT@ <\  A 1 0S PK` 20S P¼10!/KPD0S1 겼!0s/ 1a t3PU 0KQ  B K e P@įT 00 C/ 00 S0 S 0KⰱPl00 ,/ d0R `0 0.Q R a 0S0S X,O$]x]P]]] p-LM`0SP# 0/t0l0l@PPT0 P P0P00 p4ĕ -LPM"Q,P (0S%a0S  0S.P1 1 11 Q 0 Papqh0P`@ ,0, OU( 1 0U00Pb P, 0PO `f,  0 00Q0 ᨯP,@04P 0D 0Q0ɬ0  (^ĕ$:" -L@aM@M P 0S 8^ -Lb M000 @0 \0  \  \  \  \  \  \       X0 @ 0:#:90a- (0!P$ 0-L0Kp@bMPMd \0K 0000 L00 "HB@ 0000l8^$ 0A0- SPL@ 0L|-d0S0  R0Sl- 0D^p^ p-a-L PM0Q0 P0` `O- X@  40P <C-p0 l <S p^P^^0 KS- L0P 0^ -PL@LPaa=<0  am`1 `|H1 v4q p 1 j 1 $d0 *^0  0X0 a= A 0   ;HP0@0DP0: S 0S0 <<UPh $,0(4H8W# -L@PM _#P20LSa-< `P2`  0Lh`K' KpSLXXXa=0 0P 02 (v,{  0Ps 0Pl1 0Pd1  0P\1 0 PT1 0 PLp1 0 PDT1$ 0 P<1* 0 P4a=0 0 P,; 0 PP$LPP0  ,h00S S S   P<0 X 0 @+4_q $,0((_L_t_0 mS- L00P 0_0 mS- L!0P 0_0  -LP@M20S nnPa0 <  a p2  X   D2  02 . 2 a= 62  U  & 1 > ` F 1&"*0*0 0!N0 ` V l1$!0 00P!f0 <1 ^ P@:0@0P3n000cp`dP) 0: S 0S @00S@0 @ ,,P @00S@=Po  $,0H8(4|0 W! -L |M!P40 0CS 3  K30S 0  P3  0y P2K 0s Pt30a͊0C<6 S&\\\a=0pP`@00S@0@0 P 2 * @0@0 09 P2 01 P2 0) Pt2 0! PX2 0 P}a=. 0 Pu2& 0 PmR0 > 0 Pb ::#F 0 PWxQ0 N 0 PL ::#V 0 PA^ 0 Pp9 nPP @n000cP@$P0  *00S S SS  P<00cP@0d,0 L)4qq_ $,0(_`0`QL  04 S  Q 0Sq< -PL`P830a<S0 a͆ 0< $3 a  04"0 04"0 04"0 04"0 04"0 04"00 $ 0480 04@#(04@0 0;$2 a  04!0 04!0 04!0 04!0 04!0 04!00 $ 0480 04@#(04@0 0Ta= 41 U,1 >0E0P700cpCP.00: Sa]P0Sa=0 @00S@0 @ ,,P @00S@Pm< $,0(4H8& -Lp\M PH40AS<4  a0A40 >0 >l0 0BS+ dR+T > "ḜPܵfffff ff -La=`ppKXMP>X \0\Ua P@@8\PK 0@1P\K$0$0 ff$f p-L@` M 0C8=P 0SPp @K0 ፁ0Sp p0@-PP *00S SP*00S S RP&* 00B SAB0A\Ba0B7ASWDP:P*0/S 7S 1P0C*0/S7S0 S@- BR:0 S0@W @•B…P \* R :0000B R*R:000BR*PE-pP`P *00S S\*00S S R)\<* 00B S0BAB2%NPoPABaBa0B2%NPoS2%N Po@ 0P`\:\*/P7P 10@.Po\*/P7Pp@-0`PC R\.:@00 SW0 RLL%">&B`P \*\:1!`P00L \*\:000L\*p -0L$ P00 0Hf -L`PpM@<\ P000-S!010 0  0S 0@T00C0000S W  0md) m7* E:TP 0dd 0:SH R1 0  (,0"=?sD|4gLg p-L@PM0/i|P000h 0SP`phd<0Sph}00phMOM -PLpTM 0@mS񟗈                                   <                 dp     (    8 P   l x        DL|      $08 L6P@F86PP $ 6P6P 5 6P5 P5 %5@P5P5\5P\5@0S1 a0CS%lxP5 H5 @5 <5 (5 (555  0S[[4PZ4Z4Y4YXTd堤t L0tK ğ :4P@X hdd` @ PP`;VL@48u0$04p,4WicD0S0S }5>0@0 ,qWQ3VGc夓CP0V0D P?t:2 PU#T3U+T @3T%BP' !3S 3T2'PS<2C PR2R2Q2Q22 "2 m'phB2rpx"x2 Qpr p d" R\r p P2RDr p B Q4r p2 W 10S!\1 10S6!!<"<"!A0S0P00S010StH1d!0@PDA0S 0P00S00 s0g|g|08\4gtPt8$gg|MH  h$hLhThXxhlx`<Th(n$ ' 0.Dh - L0M, p0 `x*0zP9`((((T(((((((((((((((((((((((((((((((((((((((((((( (,(((4(<((D(L(((((((((((p'((((''(((((&'((('((('( ((((((((% &(&&(X&(`&t&|&&(&&''',''4'<'D'(X'xX.pHP \ 040 =<8((0-SQ0,0 8 0,0 r87 '<777 70S7  7}~70S7   7 7 U7l d7j07Phf T7_P7]('00 'O87 0'07S6 $7O 7L0 X 0 00 儠Pc|66 19&000&&H6'6 &&06$&&&&|& t65(6 $6P6 L6}%00 5P  6 - & 6pE%0 sapb ,0S0S% %5 00CSWX7 0BS5ZL C0|%0 Z Rh5  \0S))++X4 0 S X  PH8 PPPg l40P`80 UD Pt& sGPp  40S 8@ 4 ِ0S0 \40  ,0S@88@  VPXP@ 4 RḐPO30S  @娐P R3` `  3(P`qX0SZ 2Ńʃ2P GP^X0Sr X 0PH<0 rPPPP`< ^ UI < R " P:p[Pdr$ `FPpH RZ  P# CP  ᘣP PP@Z)PN10S  "@xPP` ``h0 ,0ST@0S 0S  P 0S00s0g|g|4(j \PMpjH(LjDP\ht0T<xjD|$$Lk`k gdkkkkkk p-LP@dMt@ 00xKR``cP 0ShcP  Pp0: S 0( pV/00 p<  - LPp6TM 6 6P6 6 6 6 &P 0@mS4444444444444444444444444444444444444444444444444444,383D34p3443444444444444444444444444P24\2d24p24424422422424223444$34Z$$0'4P [ 4Pt$[0x4 Xl$l4B[ T4X4 P@4 [@$@4| $00Y#0x 4Y$gP 4+jD3P bc/EP@ (.PL30SI C\clt L0tK \ß #53P@X3 0y,,` @ `c6VL@"0-SQ\2 L22Tm2k"2"P2 2c2 +"2 pBtr1p  Q`r p T" RLr p @2R4r p B Q$r p1 Wl10S!d1 T10SC55d6d646A0S0P00S0|10SlH!\1 LA0X S0P00S01 hP00S \|D|4t($$PMsggdkkt8\ltl|<LjT<lȚn ' 0.Dhl -L@Mt0 pp~5d0 @0RHLL ^00CS0 0 ä0 h5l|ld P00 -LM00S 00 tS D5 RXXT@TBP8;P$m|4mMO P-L 0SBPp 0SP' ,<P00`=<P@ ?P 00V0PP@PD0@S0    U 0S@mjTm p-L KPM_m qrR0Q0VPS 0b0CS5p;;;;;;;;;;;;;;;;;;;;;;`P$K4`P%%K5 `P*%F:`P!%O1 VU00 0xS S *S`P0  VUpp 0-LK@M PP 0t #3000 00S S 吚P<0 @    B0 0 C 0 -L8@M0R (O  L I 2|lmnno -L < 2p| -L 2 2?!1 PGP |1Pl!`1pX岘PP 0SC0C0@0T T1 !.B @0T T1 !.B @0T T1 !.B )p 0-L וP @T T 0 a=0Q㨐P@. P0 㜕0Q0, eP 00  a=4 10p4<A髗d ꨗ\ j ꢗH d 07 Tݐ@G@yyyyy 0-L  T1)00 5P`KP$1   @< 0S@0@"0/S 5P 0 )  0hP` @<0S@p 0@)  d0 0/S0000C0( $,0H8 -LpBML300C S%wwxPx4xx(x4x4xPx30S 3 222 < -L` @M0 S S0 S S 0S S S S@ 0 S SR PCyPp 0p0` P@ 0 S S0 S S 0S A`0 S S S@ 0 S S000S 01`0S01ȈЈ -LpPM`d h yl xP00p lP@@p0KT K $d`K8 40S000@@ `<@ &8@ &0&̠SC0S00 ^0  ^0x#l $P6P``.0Sl0`T f@ 0$ß8P @剨P` BP0Sl(d vP~K@8 P lT \0Sp(r@ T pk pK ?pK \@ p` P`,p@K0 m`PKݩ`VdlPT@@a 8PQ0K @KȠVP l@T@ ឪP:x@K$4$(x$ h D*LLx*Ġ0 `*\P!@l`PP @ 6P`dl P j p0Kc`@0pK kp K R@0K K 0Kp0SZxl@TVxh\Kp K؈4< (8LdXd -Lp@P`dMd h w p0KPxP |P  P P P 80DwPl (:8 `K} 0pK 8`p P0 \@ T @P  -L1 -L\Q0m 0  mQ 0  m0m0\o 0  \o(0 $00R0 R00$hc -L,0f$0 "0  _$h,d - L 0 0 0  c$h,d -L@!0M@0  $h,d -L^#`h -L@M  -L@M l -L@M p -L@M -L@M= -L@M  -L@ML 00a -Le! 0-L@MhPd\P T00S s4bP$ 0 0el^e_zjf -L@ M0 @ zj -L@ M0 @ f -L@ M0 @ e -@L0M  @~ 0@e^ -LM\\%\^0c @@@ @c  0 le^ -L 0 M\@ @@G 0S< ,}@= <=_x  0eZm`e -L@ M0 @ Zm -L@ M0 @ ` -L@ M0 @e0  0`m 00 0`m 00 0m`0m 0  m 0  m0m 0  m 0  m0m 0  m 0  m 0  m gKfe -L@d M0 @f -L@ M0 @xek"f0m 0  m -LhM 0 e\jP 0P 0P 0P 0P xtApvPTP0000<$RS| -LP $M000SP0 ,  4 0S`,0T0,0 `   P@fn, PP, 004 0W0#`pgWp 0S00 0 0g0hR R0D0hpbWp00g0h 00 0Q0@ Q B{0  Z00g0bS 0 1m,P, Z0Z @$07m0, 0@P T, ,pa00 @T ڡ{ 400D0,(y0d?Ð 0 00SdW00 0h0b?p  0jP(z{0 0p 4qdӊ (f(Kh0  0j,u,Q (0o/sĖh|Жl8hs0Qxa0Q(0wP -@LPp \` (0eh(h0`h0 (`cV@0S  ((h0S(hh6 -L@ M0  "0#(,  pdP l` PPfP(0 p`3hU 0Sp(u P 0S0jHs`U0e0 0 0\ 0 0`S 0\ \0eS0\ 0 P0UV ,0$œP``0U00 VP4 ,0`O0U 0S P0(0 g00( d  (c Տ(o)~괭 -LpM0PU bhu@gu 0iPo+m~+r1 P W0P0SZ S0SZlAAd \1lg 0gg ㊏} n P100 048CxP0 dP <P >PqP& uPAPʼ0P0 0P ʤ0P 0P W000cp0Sp000pC8qPᦎ{nocs||sRSh 0-L@P?@ ,SWXdL  0RgQ R $020 0 0R0a0 0Y R BQ$020 0R K'Hy}EQ> 0 (b0bS0Q 000C\, 0bS0S 0 \(zc xP00S0 0zP `R( BxR Ba BR0R$020  0h%0hG0| -LpPUfbP uw랈 Έ odIe@0t0 -t0 "bp@ 00h`dP !k <01QD000d|shlpt -L@PP mJ衟0A0!0 S0 P0Px}80S(0S (80S 0P(b,P(p(z0U-$0R0x 0S P`v 0p(b,P (p,Jm,p(z(Em0(pA0 0 (b,P(ep(z<0S((m,PP(P "m,Pt 001t -LL`Lp@dAPP  dj00P0pt -L`p@M$00TPP 0PDeZP00@p0Y 040`$p0 0(0 0 00 0800@00<0 000pt| -PLM@00P400A0 (0SlD hjpt| -PLP0p! r@rt`0@TcPP P`Pd<0P@0@T$0  0 x| -L@ Mp r0nhT  p` 0~hP@ 0@P@0`]h00wp @+UP@ F0 SP0-L@XP0)0Ps @00T,P $00P0500900 -L 0ea0  0 x0dx0 ex -L@`M4S430  FV,  3Pd3` 2 2 2 R` 0 00` R  R 000 @ Tr0Sl20S PRrPo0So$2  2 2 b T"0SP AqP o1 o1  11F001 000 p1R :\0SpjP@10SPP(q@q@@T q]W xoPUPE qoUPEʴ0  o0V.S !S?S  |0 00 Rdh00S H@qP Lo00  $0 0.z,|x --L  --L   -L@$MHT l, 00 pE_ 0Z0 0S ,    iJc GcDcAch`q8 q< q<0c@@ P4 ,D , 0iSEU@ @b V00ө?@T@0i Sl@ 08< @iT@DcpY8< 2"c<0  i8Cy됂i P@~ P P P P ]`2PF AP? VH2PS4\U` eAZS`F2`AU@#"00S 00 @DT00S00Tڴ!00S 00@DT00S00  e+S0d`cP*U(PE&00Z00S  Thsg`PU 0BV *0000  eS@`Pb040 ID\ <  i 08nt0  h0 V 0 000 Z R  hx 0-p-L@P`M 0p -L@pMt, `p\"Pp0T40 %, 0 \@ 0S 0S* f 4 @ 0@T4f4  4 @z0d?0V`W0fУ?p0Sl1pf 0dPPD 04p],xcP1 lz`>`aa ^_x D0F[d0 a`%`aya1,4 3U ^Y [l &iv0!iixs 0-0-L@P M 0 0 0-p-L@P`M 0p --L  0-LP:o@;o@0x 0- LP g |gxAx1 hfdd1 \1\PXfT1T@ LfH1P <f8 4f0 ,f( $f  f f f f f f f f f f f0 P0hfg`o$hko|k4ke< c hYnLe`zjpfle^_Zm`f\jP: 0aS cS. 3@p0S$SS@K PT$ 0K0S  0@! S 0 Cc 0S$S 0S$S0S0p@W:P -`L0@pM0P0S} PS0%S^P iP %P dP) dsP6 `%R\0S S RV h100P0S L 0 H RE RC 0S@ S= K  0T4 @0 00 , R 00000R 00 0@ 0@ S P000 000R@ 0S p-Q00L M@(P3T00000S` *0 phVXXjTj  0-L @ 0(M @@@ @``4PP @@;<00S40$4{0hb8H|Tj` p-L@KM`0SP 00*Z RX tw0S0 00FL RAbh( RpTj`L p-L@KM`0SP  00R :0Sp0 00P uRb(, RpXj@4e`(D -- LMKp0YM X K P+L`P@M P@j@ VjZPPp pW*pp00X  g -LM0S, 'Q Ppp, A [PO  h0~PP` *0%SP0%S 0@S f B*z` 0'Sp0W*SG,0a/UP0P0U/00PY5 W`@0 0.S G_0S , 1V, , AZ@Z f0 '4, +  04 S4K, 1VmZ D, 0 S, w,0 1PT\ 0-@PLP NZP0hHZ -L@`pM℁0Xb崂on [[gZ[c  [[V[ Z 0TU@@TPddU@@ZToh0 0` $c`u]P@pPxxiU} oY3YZZ Tq|s< | -LK oM! 1 U 0rKqKf6p5 0b eK`tupE d`%^0S P ^PP R,  ^0S` P ^D0S4PT0S4Pc9p` P N00Bo40 )$m eKe/K1B?1 *;0S D  0S C  !  P  91K21]00HK 3 `^(K2 0 1 0H00H0 X 30S3,]1& hK>K0@ hK 0A ́ Pp_0Sj 020S _l2 5Z( K21@0 S2O ZOK cPGD0D(0K W0@1BP C15h1[S @0 eK'P0S#  p10S dAO0SX `P 00 0 0kYppWuK 0Pj10 Se Sc 00S0O 00 n100[ S S 1ehptbtf@Tj`Xjeܵ kx1<XdP --L@P 0KM`4@ 8@ #0P Y% :,pKm \,08#(0,0K+ K,0#(P0*0K) K  |BU`匀m040 04 ,00CC$+ K,0K0 04K8K  4 0P0R00S` @04 4PM f4fq40 S@  XV4 0T0Q00STX,Y8@Q &YX&YmV @ x 04P of@€T}XzXlm00CS0000`m`U2m4P p@0P_l0S  PU#`Im0W (V aTht@|s$p -L`BP@pM0%*PU" X S00/U0S p0000tP Pd\0 , @T0p:00x -L@ M,,3W@0W",K@P 20S1,PUl 0Si p0 S 0Pp QPR =$P0 R 0K 000<SI :P0 A ,1RA  0eP啉V000a0S \@ [P0 0000S0S:P0  t0RH@ h0ePgV000WP 0S,VTj`|pl p-L@ `MPu( 0 L\, @ Z@0p 0-Lu 09V.0v 2l2Sx]h"RPd0@?SX0@S H k[8w 0l2Sx 0 { 0 V 40Sz 0l"R㰔$ dXt0`$} 0-L@MPP000 NG`TK:BG`0|s -LP@7pP!000*` Z00 X00S   o T T  @=IT 00 0X0 Z00X00S0000eP\m -L phQMdAN0S( ^! D1 0 W010IoK0!0 l0 rP0 00p@0S0@O` qFG`t @T  0RF @0P@ uWeYnms|s -L`@PpMTTLP10SH1H @ KO 0s s S AiP00 1S00S" -00S @0S 0S C tt`0@0STT<  Xje h cmm $ -LM@0S 008m4 0-L@_ PPPUr 0 0-L@dP0S T PP0S@Q 0V0 p-PLP M`  $0G9P 0$ P@# G00 @@\p l00B@K$PU<00( 0pT- $0 000  -L@M$@0 8 b5N(0 0   -L<h8 -LlMȂ0S 2 Gb0S2G0S 0S pR0S 0 0C0@[G0S@a=T0@p=`=(@P * 0Pz?_c p-L@`M$020 Q 0S({ Q񟗂Xhx̝0؞ R1Q(0!1PP9(@ c : ;  <phA(P(0@$P@?(@$ F=(@ 0?>(@ :B(P(0@ /C( ?(0(?(0 (?(0@(>(0(>(0 (t>(0 (d>(0 p (Pph>D(@ ph>p l  , 4 @ H P 000 -LP],R-p3 14 0P`@P00$P"0000^0 0000S `P,@00#0P00S $"600D0 0$"*000 0 0000,dk( -L4M4 ,`a0S@APB 8qPuJb  0P7 E0S%00 0 \4  0,K 0K0S ,0 aa l(0P lX<gcpcm -LPKpVM^P 0j,0`(![V`#8V`R JOK2P H@.K@0@1#Tp@K  0S 0 0Ņ G`V@,Pw|sk -pL M, e q0sa ,0/4K /aP@0 *P% PG\%1R 1|1R t1R 0P  R3/S?.0SԀ*0#R!#0S Z(0ŏB0(00SB0)S LP P F00f0 Sڔ 00Xp0st pF@d ,P0SH  /S  8tTTTT\\ _ -LPM+q`1 ;8@K0!41ZP L`K F0J pP`A1P  K0[SL0[`S S a0C!0!10 0p00P0 0T0 PKT KP@TK&TP];p  U  0@@ @Q;pRP 0bSRT0 `R0P0 80P0P1p$$hPQ,dkPjc(h -LpTM@2 <202+`\ $$2;<@K0 "ŸP W F0\P`K IP`g10S O0[SP [`R \a0BR!0h!10 0hX T0 r0s h0TKX KT X0 JT0SK$XP@:p@ U 0@@ @:00e dRT R@ dRT R @T@d00000P0K0h0 0:<02 F0OhPje$$hPQ,dkc(h p-L`PM0000S@&0{:E0u:!0000 100B S00S 0gSGS mSMS cS sS 00S0@L00p$h_c00S0ko -LH@KPKTK`0VmK`F!AP[$ K0`tC4[/S`0t!+C Sv PBMK@D@D}KpG+C P(**P2 0/S0S` `4[S B@BV000 S V+ۆ P*+Ն P:C?00 4 PC@ zC0 @&  qC@T 0-L$@$P i 0k,h -RL44 0S$ h,hkI -L,000S   hSe k -LM>P000@S eC:Ss|s -LMH}D@ '4v ! p h0 < H T  -LM\0X0 T0T0LK K0KO PK 0 S dXoa+,h p-L`@MPD 0S S,Pz-Pp '0V@,@`i,00CS0000pk - L0 0 < 0c$h,d -L$060 "* 0_$h,d -Lp`PM>lPKP 0ZP0  N@0@>SP 0IP0 =0@ST0`H0@P66$ U00*PQ(d`(h0d -PU0P1``1UL @@~T) R*00S, QA,@T)4dG-P00p`e @ 0Wp !1$4 (8,<Q00R00S0e RV`!W@VPXPZ`(hQ 0Q Q2o0 p-LMw`tP@@@T@@0@  `P@@p8  -L@,K(Mr, @WpT`X |41@t(PK@0\$0L 0P 0KǬ000@S@t 0T5 W1,҃000SS S 2SRU {:,0RT 0  i@$(, 0 ,00 ,2S x@X 1S20C2, ,X 1sS QaA1q 56Œ42 0032C@D8 1A,s@2, 2Q"|:,0X v/ 8"88 0!#8AC$!1,X48 2,2S 104K8 KP40# #$# TT  080# #$#  0 T ,  1S PP00TT T5, 2S2S /P ,0 0 4 8<20("(#8BC!1 048 <0b!#8AC$!1@`=@ X (d>? -QL MH D0Q@(@0sQ(@ h86C`B 0-L@(MP0s 00Q|0 0   0H< 0pZ0|@( -L[MPd  h 40d!ht X1 2op(PKhX1VKW/KdP,0SS S 0 4 8X,R:\10R*tXA5t 0@44\1t@/Q,(@ PV/K 0XX1 t1X(K}5`(4%,0ROK @cPj  @Zt X 0  0$ 3p TUOK$ p1NPtT4 <0 O RKP@@K Ϊ`1PN_p!Q  ßt0X 5( K,0Q00 Z:(0Z:t1X %t X"P @ ` 48 (K 1(0Zl1 0SS Sd‘1S !1$4( 0nR*R  04$(8 ,<0Z*l\l 0SS b Svdb1SM u.P`  0 4 8*\ dPUz`\` z  0@ :*\8*\ ` TPP`@`@ 4K, K00KX8@K@$P , |0R002"\402"80R`Q40L UP0P0\PT@P dXoa(h>A-BPQ`p0 0! 000?00C0 0 4 8<0 0! 000?00C0 0 4$  8(<,00C00 4c03c0S#3 -L@p`M@Q\T1!0! 0S @1 0!0Tt 0S @, V 1ଠ01 P Y  pY t 0`Vp L0P (0`0(0V,p,  5(00(0 kk -L@`AM00L)A@0SP.(*2T0p,0K6) 0h ,K.)T0P))˜(` T +@ ,0K @*_ c  -L`[ M000 00S( 1S 0000*00傏 f2Sp唠 />@(0 FP00B@dP(@0 Ff[IAo(@$h,d -Lp4M0!11R`0S ^ 0( c0S PU`3P("H3HßV 08#@K+,3 @ 4K@KP0@) PŸ9YP(0S 0"0a 00"(0 @KPK DKND0 cRPD0  GR R0CD0 ! +R MR mR gR sR 111>(0CD0 S PD0+SSu X 1@E @((0sPO Pb2V020+S 0SUb1P 0S UP U0$0 eU202P Y1010s% fQ/(dY10C1P0`SPp@@`@'c@'u 0`2000$h ,d c_ -L@$MT& '<0XST0H0H400'0044@ 0($`" `'4 Rp H0 i 0cR$ 0d| 00(0"@0S`%  r W 3@B @|'@ r@ W h3@B @m'@@0" c"(`0S cRU 3@e@W'H0T@ 0dH0"2@@ @H'"0R@R 0 d0$@ 0"T @T2E @0d@ E2E0S1  @T20S101@T, @ 2T@` 0S000S10C1T( FZ  A_[0 PsP\AlQ l1 "R1S2S0RQoPU1V  0s 0&(`F`0S 2VP 0@& 0SP% UP@t0PP U T  00  (`0S `_dgckPc|k -L Mr0S4 2"0 0b0刂0S2 000l2s&@o&LŸ.H2# 4802 ,2,R @0@ v4.114 Q 0 R,0gp``! !0 0V PI, ,` 1 0\ X0u9 10x!1pl1@`10S' Q$ H1\ <10SQ Q(00(0000 0R* 0S 40Q040 PEu,@D,pG,H00S0  j4 .x  ,0P@QpP H0 N $ e(hPj_Gcck4d\ok -LMA0S`1!"V >@0Sx1:x`!p1 hhQdAd1 0Tp0 <10401 ,10$ W(Q !1a@0  @@ 0S S  00JWp W,,P2! @4Tj` k < |X  o aXo d (h _e kl   $ -L`p Mz?0@8Su4TLh#/#-#+C0S 000 C0S 0&C0S 000,0 dC0S 0P3p4C0S 0 $# #000C0S 00 "p~Ȣ"0 S0`b0Vqs ۘ20S 0S Sj BŸQ ;^ 0\P0Y/00U00 P(2 RwXhXV= "cV6 0S@:00S:0XV&  h10S@ t ` 1P NPd<0FS  m@*P pP#, K-P b0FSV * H|@E/./P` d fEF sFFpD f F$DFg< md -L@p`P90SE/ 0 . .W  h 0-L@ XPD 00C0SX0ӤX0 Pp@ 00C0S8 0Ӥ0 PpyTYT0 $ -@L p1M00 Ё0S@4010S10SZ 1PP 0 4 8Q d`( 0"\`P`P4 ,P0/0S ,/0S4 0,Q)0S0(0 ( K,P) ͥ0P0S0(0 t( K,Pd)0SX ,PDWEVEFF Ffdmddgd -L@M.00CS0,($h00x<  -LM, 0 0D[0,K,P ʥ P[, 1"S[j`K  0 $4  (8p<,"L#\""#Ġ#W  @ P 0 W W W W 0 4 80"R - Y` -Y Z 02S 0Z02  ỎP  l`宎  0 4 8<0# # #$ 0 U <\ -Lp10S10S10SW 1^`  0 4 8<@+0+Q4A*㿤 P 1 Z{],PTa 0R 0S0#8S/( `@TV 00S 1  x(@ |+Pt v+P \H@H m+P@EFF FFf< WEVDedArdA -L@MPoVpX(0S<(0:0( 0`Z@E/|,00S00S 0>+Q *0 P d0 \E/^,ET *0S (R:FFf< $ -L`0 PMɿ08#(R2!( ế, ᶿ0 Ჿ8 ᮿ4 x媿8 40< S`B 0TL"垿LBH08#8S  0唿$BH0#8S  勿BL08#8  傿AL0#8  zAP0S  rAT0S k0#X@Ka0p0SP? 0 `Y0 PT \ \ 0410 1( F 0 StttttttPtPttttPttPttttP 0$0 0#X@ _iP8  |   -L`pFM (!P00!RpP P@ pSdHX1  H1  4QP=  PP@ ^KE/++;P E/h+ P@ @嘾XPD00C0SX0ӤX0P Pp@ 00C0Sl 0Ӥ0B PpNTnT{uv @4< ffgF$ 0-L4@K0$K 0M $0  嘢+00#S("PP, ㇢룢-w'0P@@8K0 W80S PpPW& ̼ d`0P <KP V<0S0  Ȉ(W -L@Mڢ0S@餁 -PL@ M 0SD kw00S,  00ὢ0S  餁 0-L@PM^\ \ K0K k0S0$00 000 -L@pMP 0S ᚋ0-(`K,0KP/ PAP&(/Q80,  0K 0, P1P,0 K 2,(0 0, P"P, K 0,0 ,K 0 d 000 - L:BM ML$ D H$ 004H4P0H4 00JP@ :.P@ P H9PP@ :40@4 PP2@4SCNK@D *@D ZP`Up *@T @jP PU:C>Kʟ0C@ 0CP H<4S@$| H<$B40 `P4@DT< - 0S* ,0@4 80S<4 0 00S<40 (0S  H<40<4 L40L4 Ɋ@DT 0S<4X0IP*@DTP@ 0S= C>K0C 0C\P<4!H, \0 LL @PP@ # U00R00SCKII nP<$0BSB40ȕ ȕ H}L$0 L$ 0P@4S84KC>K0C\@4 P@ DP@  }P@ 0 P<$R ;;S( gP  0@ P<4,0WP  0@ P<480TGP  0@ P<400f7P  0@ P<440l'P  0@ P<4<0rP <Ɵ 0@P<$B4I0H 4\P ş 0@P<$B4K0J 8P ş 0@zP<$B4M0L <Pdş 0@hP<$B4O0N :  @4H嬉1|P 0@ PP<4P0$  @40H喉+(P 0@ :P<4T0  @4H倉L$ L$  a0BS0S  Hqa0BS HiLL CKJJH$ B@4P$S`  H$@4(S 3@$0pS@4  0SH@L$ L$ S3U2*@T+ '0 S '0 S '0S' 8Ph0aC1 0'@4 @$ 0S) ,@$0@4 0S-#PU:@ 2 0000<4   0 P HL40L4 @4 <4S H0<4 <4[ 0 0Sa#######"#"####"#######" H@4!SH @4S8 P9 H @4S< . M H@40@4 H @4DS P H @4S<  0 0gC%C10 H@4 SL40L4 B^KPED$P-LqHP8 L`tM,d<LP\hx   -LPM(0S  ,0S -00S t 40S ` H08#L 80S,00 80<0S804 <0P(PP(P Q Xp 0Sa00S B @0"( \؇D40@H X0#X?p0Sa0 R  ‡ <0R ệ0  <0R ᱇0S 0`#VB0S 0Q*00\a l ᗇ;0`#V@0#Xp (<Pd D p-LPM`0S x0Utt$1 @\PHP壒10 8,vP 庒1S d|h p -RL@ @Kp MP`ߑp&0"S 0R"0S 0Q Q 0000O0#82 P*0 4 P!: -LM8@0S  $ 0S ` h 긻lt -LMM\@X0QT T PA>KP4[nS yS00 00trF0 0-PL$0$@ 0 0hf$f 0 f$ -LPM M8Ir474 08Sw傎K#H@HBnK1'`F 0[p@ P P@ PD40@ @TP@40ŕŕdsBnKT&0p`Fp$8 0'p@ P   0#8% 0.K@ Bt B T '0S K,(B40 (0p%}p @0.K@ Bt@ B T 0S, +,8(0,0$_ 0.K@ Bt B T 0S ,8,000$A P0.K@ BtP B T 0SL ,80080$#  0.K@ Bt B T 0S ѷ,88040# `0x.K@ Bt` B T 0SL ,840<0#< 0Z.K@ Bt B T q0S ,8<0H0#8" l0;.K@ Btl B T R0S v,(B4K0J L08#8"D 0.K@ Bt B T 00S T,(B4M0L L0#8! `0.K@ Bt` B T 0S 3,(B4O0N P0!eP 0.K@ Bt B T 0S  ,8P0T0 G h0.K@ Bth B T 0S,8T0 f$(< (@dx,Tp<Tt p-LnK`FA^K@MMD 0PE@0 0(n0S p+p -LMM`@\0QX X TA>KTP4[cS sS 000pFd -LPKLMM 0aB#Y` B 2`B40  @܂TギK@JB~K1" pG 0p@ P nP@| =P @ @THHB~K  pG$ 0p@ P% '4[S(D[`TaT (4[ "?B;C  <0R 5: p<0PB~K  pG}\80 @t T < 0 c@t 0< 0S@K@ P 0 000S 0@#T`r 0S ~ 0S l`000"00@#T|<  Dtf$F 0-LA>K@P0CMdd dTP04[yS YS0I0S44 0So0@F -LpPM@0S !  P` 0S   0S`V @`T aT  O鸻$ -LpP`M@U|<t9l |P R00 R@@T U NP@< 8@Y -1L@P M_p, ` W *1, 1`v!Wp V@: 1,  0pHPPP@`VQYK0 0 0, YA,0 CR 0R00@T0 00 S :00CS0 0 ä0" ++!P@0 CR0 @ 0R 00T000Y00 `V,oO@`9$ -RL@MJ80SP>Tp`@-(0S@|x!-*P@0  0pH -RLp@M 0$S0S Kq T`P6 0cS S MS *mS sS&(8@GT :0 ] W T(@`P0Tt #0 ^ \EL00SP 8@`lPD A@XF p-L`PMMANK@D4 0,0s p App h6 p-L@`M³08#(R1!0 Ჳ0 ᭳ьX0̌X0njX0Œ ( tᔳ, hᐳ0 \ጳ8 Pሳ4 Dᄳ< 8ဳH ("($zH "(uL ("(oL "(jP fT b册 \0S BQZQQP@\ K@TPllph"   $ 0 D X p         !4!@! -LᔐMpW  S: 8PU7 ,`V4 @hpK04#@2@8P`t ,@l0@"K0a 0K0a  ز R2 !| xϲ 0S0 CCCCCCC8CC8CCC|CC8CCC`CCCCC8C 0 0 ,Ƞ 奲  0 垲 ! ᖲ 8QW  ጲ<0P0 CR+ 8P0  CR*  C R 0R00 Ӳ 8@ @ ^ <0P0 CR+ 08P 0 C R*0R00 ᨲ Lb  D!P!`!4p!x!!t -LP`p@0#8 HD?0#T 00@#Th!! 0-@LDP0S_00@P0 0050$f f| p-LP@MH`0SC40Pp 0050$f f| p-LP@MH`0S&40VPp 0050$f f|Pe -LM 00@(0$ n0@坱逮$f f" -L`DMd d 0$ ?X ??dPbhf)g> f#gN> e>eegd0 > > !00^0`Ο0`efP>  #>"x>0p>0h>d 00-SZ Z  0-S0lS0S>Q 00-S 0 0  @0S0@DT:00@D0T*-00J=0S 2= *|=00  R L=000 ,=R  ̜ b<_,Mm}X  0ҞP 0  ɞL<P   0忞(,Pc0 6d; 00d+0 *dH _f@ b< P@ :eUfjG@T<   bM P P "e=fRG {b P e3fHG qb P e/;&f eba|;  @@KJPd 8f`; @D; 0K@ ,; IFCZ@0-S0S :0S0xS񟗯NOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOONNO O(OOO0OOOOHOPOOOXOOxO`OOOOO8 88-8$Z Gdbe8J8@8(00(0|8x8 7 l8 @8 88P8L8 @<rb0SHJZP @0-S0S 70S9 (70SjG Z00R00S1 㭓P7 ce7 vE&PP0 P0 P003|6 m6 PX66 6PR! ,6P l60S5 50R5 50R  00 T6 嫭P 7<|50S 60S60S t5P 5 CGc%a50S 4 5Rd`d`TH50S5P5P5Pw d 0- pd0S \0@L PKL0 H0 D0 P 0SY40SUOP` JP`DDP``Ut rxT ' 0R }@̒v|P|` >`0 >D0 >(0 ph>,f l -L@M; -LM00S06Z 0Ē- @0 048 (B(CR0 0 z0\R0 48CP@T0T@ }@ T0TĒ000允 0h:DP̯PQ p-L@AK@MMPP 0S,֦a :T 04 \90sPP^p 'PU@H1LH!@$pu ,\]1T 04 GKAjp \MKAcp x$4Rt$4RP %P@ MKAPp x$4Rt$4RPt\]dP@]D0@ @00  $0 ,pԮ#!$(f 0-LP@h]00 Y0hC"8̯ 0-L @P0\ 2 0 4-S-0 4 048C8nS lS00 vS000 000] E 0 4\ 0 4-S 0Tf -L 0KM#(00SE  鼗# -L MX 04! S`p p1VR 0 1 x=00#0W00S L\P ~\@  \P  00 4/SSPl\@ Pg\@0#10NY00S OTʜ0 Ms] |  U0t    d8 `0V,00 0 o-̯Tf$$ $ 0-PL@h3\0S =0S <0@\5], 0h鿦.] 00h$ 0-L8P@40T0  @0T 0h(f -LP0/S` dXPZ tA0 [0 `|[ 04p> .R /RRP 0.S0.S  /RRPp04P 04W /[0PpG@ W00 04 [ /00p\@ 048C(/00   h[̯ 0-L0KM#Ly Pl2P /vPd2 \,/P // A? P0Sz  0$v 18K1 118 4 0 , ~Z H 0\0R0S` aOp|0xSp SD `000H RH0 04/SD011 0)0S) 01S0 0 04 NP̀Q SO@J00 000 R0T0C0 ܮ̯(L2l P  p-LMTPPL`L00 O00@40@@$0Qnl됆L8 -L`P MM@Mp@ Pp}P.P P ^ PU [S}p@ )K J}P#0)0K1)[0 00  0ASK}i吗 k9B}44JPp JP14pKJ0t  )0[#S000P@.P`>M@Mp @}00K..U 7d@0S#JLP0SUN00$^̯p -LOMH2 R, 0 420S@$Bx4 @s28 n10< L1 Q1 aq0P! @1 0D! H1 .X .\ .T .01A`  .JK,᭥PP@|.,1 v.1 p.1 0,0P4&8#< 0 p@!0` @t|Pq|o|m|LX3.0P0\..0H0T).0D0`$.0JK4,00t(h,lL p-L@MPPIPHPH`p 0@0@- *q@p̯bԮ,,1  -L `I q00 RP P0S 0 4/S)}LϨP@$ 0S 0.S 0S 040. S 4L=0 00P 0S` ̯(0  p-LL0MPD0`p ,0@ 0lp锊--$01(1B8 $  -LpML/z,HDIP 0Z0R0S@ AM 0SP `Z0 04/S0110)0S) 01S0 0 04 pL P QP0S`@E̯(P p-PL`MM2 04. KLL @zK\0|K{0K|0K  04C$ 0 04 04 \0|K{0K|0K  04C$ 0 04000uKxK@pP p : SI ږP V p0: SPp -LPDK8 K,K0$MD0 @ ( < 0 $ 4 0,0 0S `NH@Tp0 Lx s+ oT80 D0 R< L0LH0SP (f-04X -Lp M`HP0  6- 0 `0,0 ,0 4 S00@ 049  48C8'S "S %\S "0 $8C 4$ 8CȠ P )B40 0 $8C8 S 04  0$) $B40 04`0\R01U000#*xJGKP PZ 0 R 2KL1 Օ J,00001U:mP@F J/*|GP 0X0R0SP LQ@T @TP 04 $JP X@aK0VK@SKZ0 pJ@Z 0Q\0yKd0 `i YJ@,  P.̯(P\Ԯ . p-L@`M00PSL J0S 000Ppp" p-L@`M00PSP J0S 00U0PUpp p-L@PM00`S8 ^J0S000pp p-L@PM00`S8 BJ0S000&pp p-L@PM00`S8 &J0S000pp鼾 -LPp?0`P@0 0 @Rp00.P 0DS꨻̻I 5@ I@P@*P@@"@ -LPpN0`P@ 00P0 IP000@P*0DS&м<@T@@@T@@@T@@@T@@omhREl -LPp80@T`/ 0A:)P' 0$ 4S000 04<SP@@@T@20hE8. -L@.0p0S 0P0` 048C8+S -S d@a^@[` mD -L@PA0pP 0`0) 048C8*S %S /S +@ (%PPH  PPIP mD -L@p`M0P; HP 00P`VHP 00P`}cDHHP00Q 0S  04)S h00pHP 4080K0K,0 P0 4 (` 7`K6 K5`KP30 0 0S}! SHPG68K;P 0B0p46((DPP*0P $-R00A'P  04 0P 0tGKP 00 X/g 048C8wSp rS xS VGSGPG’P``a04lS@KCG>GؾP H0 48C8d0CSCXXXXXXXXX(XXXXXX@0: S``&`$0: S``0: S``0 0S``0: S`` 0: S``d K 0S``p0ܾr"np3̯X<.l(f0 p-LP$@K` MGC0S0@ $0 @ %`@`G0S`( )<0 RP 0;,p0X(fP!20@-0@P048C$ 0 4-S+SH  0 48/S*S? %S= N  04( 7B!RS3B8~S0 ^S. "S?+ 04:  4|S&^ 4<S04<S 4>S0 4>S  0 48C8=S 0 48C8=S0~S0 !S 0 48C8=S0~S0  048C<P0>P00 -L 048S-S S 0000 lhB" p-LD`K@,MPP0T030K@ 8 0 30K<80 @@ Ip -0L`C☀Kp |MPL@KK0 p p |p CuxK LH0@0L H0  (!ux K "u霯H. -L≞K"KI@0"M MRAI` TKA8 08 h h h u } K 4`KH0_?0H0 0S8K@ 1.K B B0S8K0S8 .K1 B B 80S8 xWD lq.K0hd B@PP9(0R5 R3GKAAt8P'UX P"(K(0KX4P8K(R ط0d(pKR0X(S8[S  V 8[X8N`80C8 (8 \( 80C8 X@H0 <H0 p.K B B0l Kf  pt霯rtf@R J 04 \J 04\ J0 $B40  0$\Z000R J0 $B40  0$\Z000 0-L^KPE@MD+t@KDQPl : S  S/0  S=0 D8Pl0: S>0 @0I*0 0 -L M10Q0 , 4  P 04P0040@T00D40@XT810>40PPP@6`VY+p40W@"00E0h,0S  00,~@0h0EY 00D@T@d\0 h@TY p4@ h` h Vꜯht@ 0-LP0 4~S 0h>D@0 4S/S 04C$ 00 48S/S000 0$HH@4CŵP0 CD@D0頊̯ 0-L@PK0M$@402 40 10霯 -L$$@P 0h&s̯L. 0-L@P4h1h9D0S  S %h "hGEg hhP @T00S RP00S0̯ -@L 0PX":PA 0 4%S0#(@  B40 @;A0(00`0qV * fB!1248 !048C8q @@AP00 Sp `V:0 $P 0-P@L E D0 ! @8CPBP[ 0L p-LM00S@p `0S 00SCP00^T0S 0(K (0 $@ @ @ ;p00p"\@XAP<ApA(00p(t/dz a -L$00S00Sh/t?̯ 0-PPL@T0h?0S k"=P@0  ! 0hd A0Sd A0SB@0 8K"@1! 0h=L> -Lh -L@Mz00f6@ 0 h`.h. -L00P$00Si300SGt p-L0K`M#@0PS @0Sl0S `fAX0 U  pJpUp aA!/!p|L@-@0#8;C$ 00(,ȠˌQL@4꤯  -LM @hE 0-LPp0@T 0S  0S S,@T 0hD 0-L0S  04(S0 0$)R0 04<)SAPU x @ 0h(f -L00S h[D0 -LM00S 00S00S |00S2 0 0SK 0;Hj<00S8E00S 0n\X" -PL! 048C`J`000_Q D6`  48CQ 000_Q 48Cx!0`0S`0 04(S0 04)S 0Pp O PPxF0Fh0 P@$Pp?L0L0 S0, (@0bh ܮ2D -L@M0aQ   0R 0R  0R 0S(0S@@p0 $S   0K0R0  {w 00PPPS|T0X0@^0 0,@0 GU ^D" p-L@(K M`P``0S00$   (@ m 0S(K m ptD -L00S h D0 -L00S  hD0 -LMX@(0S  0Sh >0(5;hD -LP`M:p0S@ 0,K ,0 ( $ emT 0S@D,K YmT'00S ,K Lmt ) -Lp0P0aU* eB"!048C8q @ =T>P008C S`PU: -L@$zK PP3MM `$pG" "$K0G ;20S 0 R0  0R 20SBa000@Pj,<t0V0U@@TqQ:P=@@@@1@$ P`YUVVTV U QUZd!P,00WU`FJCU UUU`F<XPU U5=P U.JP$'UU$U ` U VU:P=0 U0@0@=P UL~=P`VM|D|@ -L@M$P(0SLhI -PL`p@ T T P P@ #T   0P0P00S@T; TU ,\P@ P@ @"T'TV` V`TU D40@  V KPp T T TU WXpep0 048C8S$ ,,,,,,,,,, XXLP L0=D0 @( 0(x.LM.. -PL@0ML <0S< <0S( <0P0J>0 -LMt@ 0S 0S O 0@hD 0-L$KM 0S0 0sP,@% R"$0RR0 S 0R0 00 R0  0Q0  0R:0S0 R09T@ 0 D -L0hꀮ -LpP`M━0S 00K ,` (` $` 00 j0S; XA`t0S PP,M 1PQ WP <P`P@T 0 48C@ 0 0 48C@0S0 @T0&W00Sd  _X0S0K j$@P 00tܮ2 p-LM@T`10S 0(K $@ @ @ (0 j01@0Sp <1 C0Sp `0V``;PPN";P ;P900  R 000 @0R  Optܵ(f|BL( -LPa0S:ܡ@0Sp 0 4S=S 0 4S=S0WpSPQ 0SN @0SpD  0,$R=R B40  0$R=R```X P%  ;P ;P彇00  R 000 p0R  p0SWP 0S@00BL( -L@M8p0S`. P0 48CP 0 48CP P 04=S;P ;@90Sh:P:0,0 u0,K(0 ,@900f頯l^ -L`@0Sp P0 48C 0 48C^ ^ 04=S\900 P 4h10S ꠯^ -LMP@@᩻0 h΄ 48C( J\0000 8R 9R0@N đ?0S Th鄻ꀮ. p-L`PMT@0S-9zP U(P0SUp"( p-L@`MP 9P`@P tP0Sp0Sp0SPph 0 uPpt" -PLp`9q@`048C(JX3000.R eR ER RP`/ MP@R0 lV0 48C8:0C;S񟗎l$0SOla/ P@8oq0 뜈0S; 0S7X[Q. 0S, 0PF 0SE; m00009/ 6@ 0S+' 4 !_@ùP8?N@ @@0A/.$/,/.8/ -L 048C( 0R R J -L`H,PK$HMp HsT 0K00tula\0S;  ?^@ 0 ( 0 l\逮D/8/P/ p-L@P`MP s8P`@0S@0Spd 0PPSUp N$ P0Sp t" -LH0pK$HM`P H K` uvP K`, $0R0 (0R00K K0K⥹P(OX0pP0u v< 8808T0,p墂ԮL(0X/`/ 0-L0@TK.}Pfvt00s0 K0C{R8 p08 0B40 0  0${R` 04@' 8C8[S0 4]SS 0 4]SS 04? {S }SZ J 04Z 04|TPR 48C8[S ,S D{SA }S >0 4]SS 0 4]SS0 48C8,0^\ZJZ"D4(0 0 04( 05K@5D4K0@@b681WdA8 @~DPU,(400 -LQ Mp0 P0SP 0S@TZ 0 4{S 0 48C8L }S 04F {5PA , KP`f3,V00-  1!R`:0cC1dSd f@gPgDAEQpQ, U `FH  01 BR0SQ  000S@T00YPp -Lpd M00P, @T: `P5P# D,0`V A$1010`,00UN, 0d^C0V@A00 5,0U, ^@d@Tx00S00,,K0K 0P 3,P@T 0 4~S,)@T,  R-Lp`$ R &R #"60 6|PKO5``k5@e5`0SE;5`L(4 -L@P0MM1pPpT9 0S6 HP W@P lPP !nPK5 0ȕp p 50  5D0 ` L0SP0SP0S 0(U0SW @3@@ ộ̯L -L`,PKMtt1pA lq0P0 0( ,` @T  0SP0$ R, 0S0`W0S0$ 4s0P00S@Tb5t0 lP3T40S  `$̯ܮL2(f -LP@M0p 0S^@/0 +0븀`P H0S@P  0P00S@ %<T0 0@ܮ̯40d - Lw0 0 p-LP`M@Tp 0 @@ 0@Tp Q 0$ )B40  0$Q\-48=S~ST!000 {S 0 48C8E }S 04? 48S#(9 8C8`S 00Q`Q0 \Q 04$ Q`Q 04{Sd 00 S0L 0  8 000 048S#(\ܮ0 -L@pMXa0SdH1d 81K00L/1 0 4`SP 0@ 0R- 4+0 4`S@ 04S`SP \S 04  04S`S 044`<30e   @  8 -L*KQ@ pMPK=PK0P U!+@K3&P`]a f2RatP 2``0 $2@ )B40  04 S S00;00 0$82 ZK(PE$PE$2 2 2b @T   PU@ 8P 0#80C$ 0 0&?@a@`W!ZK(PEPEK(AA*!appN0S W@/Q  (K000C4Q0 Y0 4HHTpGP T :Kd0S T T *Kd `t :K`0`(T:K(0C40C` 逿l  P \ -L0 00CS0@$Ӵ0 08 p-LMxx@0 d0CRd`dP 2@00 0!0 0 /0 p  8 -LP`@pM 04^S@p=0 0 10K3d P @0S  0SP U -LP@0 $0(4B?QȠ@ Q *Q c[Q `PP ` 04 \X PP  04K 04^SppW@ 048S`#(@. 8C]Q* C8ȠVȠ-Q0T T48C[^  048C8(]S( 8P@8S`` P`` 048S#(@R4] VB888S P~3 -L`p 040 48CP0 g0f SB0@d000 @Al0 $B40  0$@0 $B40  0$  0-PL@M0Q0Q0 P00S0^KSPE0 /y/00 p-L`PM00 04 Sp , 04 048!C800PCJ0000P 04p@Q d0 00bUS@00/Q,00 0ph̯4 -@LPpU` @@ 000000 00`4 -L@Mh p-L@P`MZ, ,Pp 10S 0(K $P P P (0 ^Q! 0 4-S 04 8C8hSP -SrS`N 04Q 0 4-S P(( , +$0, ,K 0p̯t4 -LP@p`MQP 00C0W000  0X i0S@T -QL@M  0 8z 0h</ -PL0p000PPH P P 0 048CPx00S / ` 00@`P`O 04 S@ (f8L p-L`PM@^0S@T p 0 04 S 'S -Lp`P @`z/ 04 S@P 0-LP0S @000SP0 -LK(HMMdde 0\U4C$S 0 0 000N8S#H J Q Q$00P ;QR &Q  QL #Q+ {(0ASxE>Q <Q\QC |QnD40@ 04C$S 0 0 t000 xZG4p0$ 0p40SL@0 $B4@0!x  0D H8 S\W D40@0 $8CB40  0 D000 H8C Q(#0S00f3 048CQ \0000蒟98#Hp`8CȠ2 L8Sp`} \S%R0 $8|CB40  0 D000 HL2 04(RB(F R98#HD4@\@0U SS4JLMJ00 04SD \P.0 $8CB40   0D` H8C QX!0S00ED1 048CQ \0000I98#HP "P``,x #\00S D40@ IYD40@0 |$B4R0  0 D000a H\n:K(0C0 K0(@0-$@0į -L@M0 48S#Q  048 C #   t!00`0 48S# 8C000,Q  048 S # 8CQ 00CS000 000P 00CS000  P H0 04P @$x0&,04 -LFoKGKGK`F zM0 J$B$0R1KK  0 48C8 1 \  Q  P )E4000$00P{U 04C$SP `0  048CX5P?U#Uȟ0 $BE4R0P  0 $(0BX00PE$ 0EP `2SHh11111111111111111111111T111T111111111111111111111111T1XO6 7 PP`F.GK000XQ% @/Pw0 00< & Eh000c V5@#P5`2Ɵ 04C$S 0  048CXPU D=v0 0000_U0S@</ E100 00_U00S  # V5@#P5`2ş 04C$S 0  048CXWPU 0S00-Tw[U>P@`∀Hu 0@E4C$S 0 0 48CX/P UE4/ V05P5`2]UV:m{GKN 04C$S 0  048CX P:U$ Lt0 DD$BE4R0P  0 48CX000PaUgUgU$10 $1 0$BE4R0P  0 $(0BX00P$1gUS aUYgU$1Hß0 $1 04$BE4R0P  0 $(0BX00PE4sU0PRĂ0 $8rCB40  0 48CH000@D4T0@   \20 0 00_T0S, P YJUJZ0P 0 $B4@0  0 48CXWPuE4ZsP P $1000 U@@TV-H, 0$4C$S 0 0 $(0BX00(P:U E40P 1{SL 04C$S 0 0 $(0BX00 P}UE$P `0 L03} PY)00EDT@`FPQGK@@"$@0&P$ p-L`MM*P@P y*l0P\0TU0pQ8P K@ *0@*0SKA0*@px@ -PLp MD 04C$S 0  048Cxp{WG40ppl4h4 \4+P H40P@4 0  (40R  R 0R  R 048CW, 0 #s0:@0`0 $8pSCB40  0 48CHP@P Pp 0:T,0 00 D40@)0 $8CB40  0 $(0BH00/@  20 0000_T0S&T0:@,0 0 >,K 0K P 4b0 $8$RCB40  0 48CH000@*TD4@-@0-T 0K P 0 $8CB40  0 $(0BH00@0 K 0B, Bl!0Q0,   RZ, 40 $(BW00:T0S E0 $B4@0   048CH@:T  {Wh0 $8XCB40  0 $(0BH00@}TW40$@D8L040 -LM f0 V$6BR  0 48CHX@aTgT0 $gT8CB40  0 $(0BH00=@gT aTş0 $gT8CB40  0 $(0BH00@&0DRS3A@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E@E\E@E@E\E@E@E@E@E@E@E@EAA\EA\E@E@E@EAD$000, 04X 'ß0 $8CB40  0 $(0B00  30 0 00_X0SPhS X#0Y00wC s0 $8cCB40  0 48CH000g@ T T) "U0Y0<0BQ\T0 $8CB40  0 $(0BH00D@T\T\0000PD40@$2U000 0$Z% CQKd'q0 $8aCB40  0 48CH000@ T T% 1U[cP\T0 $8CB40  0 $(0BH00@T\0000PD40@000 TI \8%'00S  ( h0 $8XCB40  0 $(0BH00@:TE $@0B~«>4 -LT1Mp@ 04 KpW< 80 D AJ  D 40K00`0 D P- @ 0Z0S$ 8 K<480@ SP S P 8 K<$@P'0S 80S UO'PPpWZZ]D04K 00 4(f -L0e A@M0R$HTHTH$HTHTHTHTHTHTHTHTH$H$HTH$HTHTHTH$HpPP_ 00^{ 0K$J4 Plq`U dPL T * 04C$P pG0:  04' @8C8&S \S0 4&S@pWJ T0T4C$ 0 &0pW J J&)'P@ T0T4ho&`l&p`W0004&00 & 04&(fB« p-Le0A`PMSh$KKKJKKKKKKKKdJ$KKJKKKdJ&0 48C8@ S SqV 049C$ 00 48C8p%/PtVp-&@0t 4/ShV &@@T: 04/S .S eVN&pK&0e   p@DT: 04/SeVph8&p(f0 48CȰ 0 48C8 \ 0 4 -L`pԒM0Č 8CL40 0 48CH000 @*T/, % $T %T ,-T ^T '<2 r Q 0 Qw H00 WpQ0000JQFQ000X? 00 7.!0 00' P0 $10B@0PC  0 48CH@   0000UPSPPQ00H00, R 0 $8CB40  0 $(0BH00@PP 0SQ_$@D1 -Lh5M 048CPL5 048CH4 0,4C$S 0  048CH A@܄0 48CT4P4P #0D;Sk0 c@0   0 48CH|~f -LM00S0Qp00C/":CXQP0PULp`6OQ PU`00h`0HD| -L0 S0 S S X0  L0H0  <040(0 gk P\|Ԯh1 -L| 0S0 Sd0 `0 S P0 L00 00 040(0 ;k \P|Ԯh1 -L MT00mHH0 00,0(0$0hU|P \ -LM00ĐS0000S0Pp 0:Q`00tPS` @ @` 0 `Hį|P0S S0S -P@L<0M@0Sdସ 000S 꼗0S0S 0-L@P0S0 !C0S C0S0 0S  0S  0S0 0-L@P0 P0-L@P0 0S 嵸0S0h鯸 p-L@M≸0S`P 0Sp p-LP`M@@@m@phP0 48C8 04  04 048C 0-PL  @]NpP@PT0P00T D00T 800T ,00TTLN@T0l -L?N=N;N0 ,?P0 S0-0L@P QޠPU"N00?P0 S0- LP@P00á? Q  N0h0 0-LP*NP@ u00P00S P  PM 0 p-L`P@MP @QJշP @TZphP0 4-S  03h0000 48C8S  0000 -L@M~hP 049C$S 0P 04 049C$ 0 04 -L 0 OL-0 48C0 48C^ -L,0AM@ , JK0Tvt00S,X  T@JK,Sv00CS0i ,1JK,HLȯ P0-L@P0 0 A(P0h@T0 |1 P-Lp`P@3 0 048C8)S &S  S(SP>S ;S|S PUZbP TP@U h@TUh꼾 -PLp M 0 4(Sp0 04)S W p0 04)SW &P QA0a4K p0000000S xj 04 ,0P,@PxY,0 S 00 00000 ,0000c0ayu L p-LP@PM` L@IT`Pp p-PL@P`M 0 A0P ph@Tp|1 P-L@p`` 0 48C8)S &S (SpM>S |S HpWFZbC 04|S> P;  P`5W3 04&S. :0(RRP R µ0PP0!00pp#8!0C$ 0㱵0@ 00 0P~0 `VW mcy0鼾 P-L`pP. 0 048C8)S  S (S;S HXp0@0  <P00PU m P-LpP` 0 48C8)S (S` |S `F 04|SV PU m'0@0 `  `` P-`Lp 0 48C8(S &S )S@ 04&SP `V mP@00 P  PP P-pLP< 0 048C8)S (S-|S *A(Q&㶴`V@ 0 04&S0#80C$ 0000 0V 0 04&SPPU m  -PL`M,  @7@P u4u4u4u0u0u4u0u4u0u0u0u4u4u0u@ T p V@E 0 048C8(0CS1uu8v8v8v8v8v8v8v8v8v8v8v8v8v8v8v8v8v8vu8vuYpYpHX Y 0 S 0 A PpG0X0 0p@ TWpP 0 04)Sp00@p V8  4p 0p 0 48C8(0CS񟗦Dw|wyyyyyyyyyyyyyyyyyyxywX 0 0)R00Sd000 X4@ |Xz 04>S0#80C$ 0 P lP 0, #80 C$ 0@& P (P0#8` tI0Y 0B I40 006R}00$~H000Xs0x0 v  0av  b c< PR"0P0B < $P xL0 xs00 v  0T* v  0  "B0<0~x0x0 v  cLv  cBc>P@ >x v0 Pv 0 kc% gc!xP@ v P0 Ycv 0 Nc Ic614000  Y00 0S 0S@0鼗D1$11LPPh< 1 000ᘬ -L@M 0\00C0 \0 CR 0R 00mcL0 CR 0R0 S 0@0Yc霬$ 0-L@PMP0 \P7cP 0<00 0P0 0000B# 7R!\@MP 0-S@^S@ ^P0?S0DK @[P0 ꠬ p-LP` M@"0DVS񟗐ꔅ܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅܅ą܅̅܅ԅ܅@@K K @@KT0@K00K00K: 00d0PC-@@KT0@K0 K0K0 0K: 00dP\'"    /0 p1 0-L@R0S[3P|0  R 0BUSk                   ؇    Ї                                                    ȇ\ 4' 2" 0a .b ,e *f (n &r $t "v 0000 \00M00 R^00?0 R-00^00@00\00  Rh000T -LpP@@T@`@ /@ DC 00Bj00BpBX1 0 0S0 ᤬0 0S ᤬ p-L`M`0@T p tK` 9PUp.p餬2 p-LM|0`V p 'R00"R@@TpH0@ KP@}p餬 p-LM 0`Vp00 'R"Rp 000 0000-SX.T0  p  K#P@Cp餬2 p-LM`0\p 'R00"R@@T @LDLᙯT`Ph `Pp0 @K嘠0P@0pp@ -L@M0S QD@+. 0"S^  .0 <2X2  -LD  h(`x2| -LLM00<40S 040S$40S hPKlK mP@ v0Sr003t   3`V 0T `V/T 0:0C$ 0 l0S 0C$!  00430S(P $_,H l0S S S* B4 0 0<C$ 0 l0[00 !400 S  B4 0 pP l20S`20S@He0S(0 40,@@4O.T 0@0C$ ť 0ť 0P8U#x 0 <UC$ 0    )B4 0 0@0C$ 010SEP 0*B4 0 PU R P R 8 R R(1 P  10S1 0  P  @H x8 P @9 i8]0( l 0)B0 0 tXh̯(@@@|`@ T 0-L 0 M@0T 7( 40 0 , 0 0$PK  4K C 09C$  0L  C@T0 hT p-L(`K78K$MP , 80 4 0 B@T 0S0t0P 00CS00S㘺 @P@T B 0phd -LP,M R P R@ 20S27 @T0pK7@K 4 @@0 < 8 B@`K7 @0 < 8 4 B 0@8T#0(@07@0 B0K B1QBR1 0  P  1 7xxP l1d\L0 \PT10H0 0LKD0  _ 10S 10S 1P rP 00#Բ`@Q  0 R00`@TV lPX0 ]!lV `00SsW3Ԯ@̯6`~ tdz 283X p-L8PK(`K@$M000 7, 80 4 0 Al0 R 0S 0 0,0 80 40 00 A R A00p鄮h -LM(0@T 0S@T h -L@M R0h60R @ R' 0T00 09C$  0QH 0P<0 Q  0PQԮD3dh p-L@MDP0P<` 0S0p0Pp` -Lpx@MV`01  B4 00 09C$ 0 Q101@h0@@00 0;C$ 00 0;C$  000Qt 000 S  0S`*0 0Q000``0 00 R 0S R0Q\ 0S P 0S`40  `i\@dh` 0-LPU0 08C80CS1D\8X$ @0S Q0SM0S08C80CS <D,44P0C("10# 0S 0 $"0C(10#0 0S0 T0T0@0h v4B8L(" -@L0 0$4S@wlp0OSd`P ORT 0P 0 00 0 0 鎾0 00d\0 00\d -LpP 0  4 R R@ @ RTP L[` <[@T 5 0 d`3h3\ -LPp@ M50I R P R0U    )B4 0 0@0C$ 0, ` 0$V00(l"(S   X0, S (4 4|0$V00S 3 4@ U3#3 ^@@V+ 30V - 0X[{4@ `3 tL[@N d3d#0 X0, 0S 3#5 Z,0 ) Z ZZ Z * Z '2"3, 0R00S R 08=0# 2 0!T2  <Rd`"[@T2T Z Atf4 0  4 0 &14@ 0  14@0V 13@@ 1 0 ,P DA3i 0 )4@ 0   T0P3 ,$ 0<N@0VT0 3@  쀟0 P |@37 0 峳3@PU@ $0<3 0Y 逮 `2222< 222Ԯ222\.3̯p3 p-L`PK`H @\M  p0K,w $00bh0 C (00bSh =)d0 -d ph0Sd l0Rh Kp0K@Tp K0p8 -Lp 0S00 R 0SsP 9;Wp`0PUɄ0@T 0S R  09C$  05g@T0PU~h 0-LPPZ@@0S0 0S0 -L@MF@h+ -L@@M70S 0S -Lhp -L`@MP 0 4-S 048C8lS5P@ 03 A 2000; C$K G?P@4P0210!nY 1Q0!fY T @2 ?Tl1 2SL1000 $K G?P@$00S= :0 4sS 04P PU 0S( @pᬀ0a0S {P0TP @?T@T 0 40S@ ~80 04`T@p3L -Lp8K` M20S780 4p 0p ,p 2B80 =p0S  P`X pH2`tVz @Tw 048C(%R9P 0 8R#0HS00Td000* 1 6kJ`<P  @.WX!0X XpXX`0 1R(1000-R9? <K 0<00SP 5 0 nX <P V 0 `XpXX<` @TD@P 00  <W ptܮ2Ԯt33:33 -L,pK`@7P M<K <0 8` 4` 0` ^< 0 8#8B` U 00C$ 0 0̃, 8PK7HK < H0 D @ ,; 0Sl ";1z`V El P>4 0 PS P L@PZ0 00s0  200  ልZL0Q၍_ :tdz|dh -L00s! S?㤻뤯 0-PL@P$ K M4K28( 40 0 , :TM0sD0D~/㱭T;$K : 0S000Ԯ3 -LPdMT h X \ `0  T 8X C8 0CX S?X,ppT 00 4 S T0C8#50#T 00S T0`T 0 T:T0x<0SL:h ` T08ST 0@N P2T 0 R[ 0A ]P T 0SM ;+ AT  8T0#8;C$ 05T0 0*T0#8;C$ 0'T 0h P T  0S! 0#8:TC$ 0T 0 PT 0S 0#8:C$ 0T 08S 2T08S- :0Sd , P>  :R& |:R# t:R l:R d:R \:R T:R L:R D:R <:R 4:R ,:R9d 0SedP  9R 9R 9RT0#8;C$ 0T 0C( "20# d0S 90Sd\> <  t9R8T 8S X9B(dP* h X Qh ,Y\ @98K), 80 4 0 =9@XTP H0S7  .9T08X^X0S80S @980 8Kd0X(40 00 ,0 9@H8@8KH K80 4@ 0@ ,@ 9$80l0 880p0 80t0 80x0 70|0 700 700 700 700 'ǟ77@7@7@7@ČPHK 81Źhh < d7pW(Xǟ@@l7p 7t 7x 6|6 6 66 6 6vf巢@V峢@尢@T@+HK 8k^<^p@K`K K`KpP00偹800S" p-PLl`lPM `-0000` P@02 @00 0@@phT8l P0- L@0P< @0@40@08 -L@M0 4+S 040 4-S  03@t0000 048!C J400 000BQ ㊳Tn -L#P 00S(f Q0-L@P 0S P0P0 @T0 0-LP@S@ @T 0 4 $8(C8B8sxP00 0-PL@ @000h̯ -LPpX@`0 S "P Uw$t0 mܮ2 -Lp`PM@T 0 4$8(C8BXsp&PP UPP1@T㲛1@_00 00piK/ -Lx&ppj Rd0X \c RPPP4!00^0  0UP(0 $0 ̯L<` p-L@`M0Sp PPPU00Sp L -L@M"P$ h̯ p-LPM呛 0R S  0S 0S 0 0P@ 0S``1P@p phb -L@Mh(f -LM@T<@8P 00S) hdҾ̯ p-LjK `FKPM0MP  " 0S 7@40@@ Td0d%0SH 00S4 0SKASpԮ304|p@-`@Tp 0SPPQO \ |Q\ ^ ~" ^0 0R  00S0 0R 00'00 00S 0 0 0 0 0 0R 00 S0V\ | X\VS0R 0S s KS# H0 0R  0  0  60 0R  0  00$  0 0 0S0 0000 0R 0 0 S 0000 ?0000SVpVp@Tp; p-L@M00S 0 (K $0 0 0 ( 00S @0S0Sp D`pP lKV(% V) % % 0S@ @ 0S t| p-LPM0S 1S♙0S`@ (C0S00p p-LPM0S 1Sy0S`@ <0S00p p-PL@Mp `0S 0 0YP 0R B40@ Q 000^0@ R0000p<@ p-PL@Mp `0S 00%xP 0$ @Q 000,0@04000pDH0 $B40  0$ R@-@0 $B40L  04^ 0\00^ 04@0 $B40  0$ 0 48CP P0 48C8SS  04 04@-@48CȰ 0 48C\ \0 48C48CȰ 048C `R@-@ 0$4(8BC(P PRbP@T -P@L`0M@ 04d=0 $B40@  0$ (f0P 0-@@QPLP 04 040ed@0 $B40  0$@0 $B40  0$ 0 (fP 04 04@-@0 48C0 48CP 0 48C@ -PL@M P0S 00彗0 0$&  p堀 \00P`Q 000得0@00@Q 000寗0@ $000LP P-LP  040edp01 @R *RH` ᆗi@/@@ 婍XT - LRP@$Md`* 1R`:ߪU0:٪@T@ӪXp0 p pom@PKd 0 hmd`Ὢ@ᩪ 0 Vm4\4 0-L\@KHM,P,II ;0錮, 0-L\@KPKMPK(*I 00錮, 0-0PL@TP 0S@ 0A P EP 0h3G- 0 =BR0 A 0M0 0 0 =CS A0 0 R 0 0@@0,@(D0$@@0 @ 0$0,0@0@80, 0@0(@ $p`$0 @(P@,0 00 04 800 0<0 D0 0D0p `$P(@,48<@ 0Ѝ?B -L`pP0  cPl 00b@QQQ@abD @ީA 0 AcA@ԩ0 PP 0S P P %P 2d!0S D0C3S񟗙t     $ T` l |                          1U@   0@D W$ $O, ,Lp1U@7  0 0' 01/ :0 04AZ  E - %3#( (0U@ 0c/  D D < <8 84 4@ @<0 a8yGPS0 m '̯4D4L4 -L M  l=ɂR ͌D0  @00`C0   0MG逮P4 p-LPM P@ TP YD E8EᕬS00000 ᆢPP 0 6]DD @EXLP0`0Oܵ|.d4IJ4 0-@L@P0.00, 00 @0 @0鰵,h R-0L R R RP 0RD騲4 p-LXaXAM0 0P0P010P R3b1 Q + 00Q0# 00C S0 P R0 A Q  0xx S 00S 0 00CS0<@0g00pH,X p- L?0M 0 {`00P@@j0S  0\/S PTXip@t Zl0 R /)L呃HH0D{p{p$uv444< 4 p-LMP0S /[`P@ 'NC 0hhDddDp0S` hZ`4 00$ p3|4IJ 0-LP<00S 0@ZP h700C -L @M88Z2`P$0000@@T(̲Hp@-QPPE4`@ 0p0 U PEp ̲ T00-@@L <0<@Pᵰ]D/. 0 PU0,(̳Գ 0-LLPL@0 S@000S00 000,(ܳ 0- PLP@0SHt<000,00S0 Pç000,ܳ( 0-@L XP0SLVD000400S$ JP00,ܳ( 0-LPKML=k@0S0 9 00 0 0 5 P-L#JB hC< 0@6Pr,4<L\l|  QQQQQQ Q Q  Q  Q  Q Q QQ -LPpM 0Rk0XSxS-0P@ `Kq0p1@`x[ T00P00ST0K!@0T1@K!0Q 020@T50R70BSbS30P@ `K=0p1@`' T00P00S?T0K!@0?T1@1 K11S 0Q0@T$0  (A505 -Ll00ST0 0Q<0< 0\ړP hH5 -QL@P`M@p0 0#0@T` 0᫗P@ . ap)@@X0 00#0@T` 0᎗P@ 0i̳T5Գ -Lp 0P MPP`)(K  0jPz@0 0#0@T@ k0p@`V@cMP WT5̳`555 -LMQ0@ T TSAPp 0S0@0z밀@0TP!;P@` 0 |Qw 0 ;0S00 SP0TP58$ -PL@`M2巙Pb ,KP`@ut2PZy P 04`0C$ 0 P$, 2000S SP P1{Pj ,0S 1rPV1`J,KP` ,0 Q6ڀQtq0 Q@L00?P?D @CA 8@00CS0 A00 00CS@0@0m0@,  ֭`X@`0S lP PD0400SP@ e$555  604Hܵ|X -La00S4Pp0L00ϧPGn? @&@00CS0@00O00CS@0\@00=$0 000Hܵ|XP@-p`@Tt0tP 1S@ 0NR00 !000CR00T0P-pp R `01S00 S01S $0 R0000 -@LxP000l0@h0@d0d`@`0@00CSHp@00~0 hHX -LPp0!SUNP@ >0 @0P`0!SUoVP i>X0 P?LPG?D0 @0R< ?,00gg3|6(6T@6 -L@Pp M, [2 0TR" 1`0 PPo!@3A1000P `W`1 |Pp00CS0|A00 "00CS000CS0U0x"0CS@0xB0N0@20P p@2 <20S  00C0S0PӤ0UPu 08C8 @ U Q6ڔ0吡 Q@L00忥P7^=\ X>TT>00C0S-"00CS@0@00- U00Pp 0@ += >=W `0 00 pl0 @0 00H00S D00SWGHܵ|X$@p6 -LP@`M!\AS1LP@ <0 H> 0Pp0!SSTP <\0 T->PT=H0 D0R@ >V0f@43|66T@6 -L@p`0SPT00T00S& O R 00T00S 00S 0 0 `P@00T00SP0S 00c`@,$ p-PBLu`@M x0 0R0 P B<4 0=,,<pPEup@ܵ|6 -LM, 弃 0 SP`UAQP3P00p#U,dc0`s U@L00bPڪ<, (f=$$<00CS00"0CS@0B00B ,0 PE S 00B PEPp  "000S S \h<42`V,$0  V@L00P; =i<00CS0G 1 BR@ A0J0tA! ᲩWAP ,0 PF S 00B 1 Q7P00 Q@L0ɣPAh; < <00C0S@0 0 H0\ 0C@S0P X@005  00`<H8ܵ|X 5 -L`M4B00C0S0PӤ0?SPuR Q6q0聟 Q@L00d Pܩ; h<;00C S0A0000CS@0LA000P `1  U!00000 0 P p0 $"3 : <s;0 $` B4 0 p0` B4 V 0 yV(000 00 0H ܵ|X$66 -L@`Mp ;p@Dt *Q 20pWڠpDy \0P0 @^R00S 0 CR w0Rq0 CR \@0R00<Qp QCP 0C1 eQ!0QT PR 00P 0 B#3R0 t0R P 00H;0 80 B1R0 0R P 00; 0 B0R0 0R P 00;p0C\0\ P 00T;y @`]<00CS0 0 ä0 ;6 $67 -L M0, 0 吧P@0 000SrS45pP EP 5 sP xP 5 44 *4 00 4:9$,0'p, 0 R, 0 !0  00-S ,0S`4 0 K  0C0 ,0 uvP80㹥㶥㳥HPP :39, 3R , 000S nP 0 {PFP 000!S 9, R l80 00SDP9 -PU,30S #z:2Q j:RP@P,b0S% 20S!R9P 22 2PT2N:E U 04`0C$P @H2000S S 49, 04`0C$ P 02 PP PP 1 EPu u 5u3{t1(a@@H/\0[9ᩜP},1<1 81P4*㜜P 01 1P090 0R| 9Id@}PQ|00 0PD09CLPsT@|<7DdbbD7H7\T7Dܵ< $h77 5  -0LpP `@0 0 00 0 ,R;R0;R0PXD 0S0S0 000S 0 0 p鰵8 -L3@ß䣟0 00 RS0` 0FUS)++++++++++++++++++++++)++++++++++)+)+@+**********+++++@+++++++++++++++++++++++++++++++)0000 00r R [00 ,'PP pO0"S$ ^V-V@e@g00c^V-V@D@^Q!8600 P'P@ pK*0"SG,0Q 0.V0001@:Q /VP@ 0V00*Q 0   P@Q 0;V   L0 \0@\0 0S T000S갵47,8 -PLpMo 000 X 0H pS5PIIIIIIIIIIIIIIIIIIIIIIIhHIIIIIIIIIIIIIIIIIIIIIIIIIIIGIIIIIII1Ih35IIIIIII:;IIIIh3CIIIIIIIII.I//0|2h3t45x6<7789IT:;<P>4BPCh3CEIxF 0 nSP lS0 pSP0 P0\ 0 R0^=0S =MP 0 nSP lS0 pSP0 P0\ 0 R02<0Sf $= =` P* iLsP 0, nSP lS0 pSP0 P0\ 0 R0 t 6 <0S. D<@<( P,0 0SP5;0S ;0S ;0S 0 00 P@ 0 nSP lS0 pSP0 P0\ 0 R0: P;PP0S!S u5 R:0S Rp PX: 99H:0Sz 0 00a *P@ 0!S$ j 0\ nSP lS0 pSP0 P0\ 0 R0K0ST $5L  w0y@Tx ?<9PGXgXPVX00GXZ  0LnSP lS0 pSP0 P0\ 0 R000 0P80S 0nSP lS0 pSP0 P0\ 0 R00S *70S 0 nSP lS0 pSP0 P0\ 0 R0&00cS0 <'0S  6G0S3 0LnSP lS0 pSP0 P0\ 0 R0@60S @sXd6P 0nSP lS0 pSP0 P0\ 0 R0Z50S 55P '0 @R0 0ğnSP lS0 pSP0 P0^ 0 R0) 4sP 0,nSP lS0 pSP0 P0\ 0 R0h4d4 oP4IP88tP30Si @Ts30SoX TT 0nSP lS0 pSP0 P0\ 0 R0 30S 43P 0hnSP lS0 pSP0 P0\ 0 R022 W2P 0nSP lS0 pSP0 P0\ 0 R0c11 10SY 0 nSP lS0 pSP0 P0\ 0 R0< 0S00S0010S- 0pnS lSpS00\ 0 R000S 00SqXg P^777Dܵ|7s85H`Xdhl$84 <8X8@4@,l8t8T8887 0 00 T00Sh0 H0 P@ 0nSP lS0 pSP0 P0\ 0 R0(10S (a0S0!S~2 R0S (1RlP x10P1  A 0gS  S *00C S'pS rS0p p 0p0p08``  "TBP p+0"S "0p00W RW h200 S20ShG 2   0 S 0 S9 c000W(3@  p P@00CS0'dC00  3T P fm3#3@ 3 00CS0C00WJ P D0$$S00000YD$00#0X$00# 00 0tnS0<00 lS   pS0 0 00 0Z 4P 0nSP lS0 pSP0 P0\ 0 R00S 555 iX5PppE<P50S|pW50S$o 0nSP lS0 pSP0 P0\ 0 R0P60S "60SD 0nSP lS0 pSP0 P0\ 0 R0' Ps qZ QZ87 P 0 00DP@ 70S7 R7 7  7LP 0nSP lS0 pSP0 P0\ 0 R0lh0S0!S0Q0Sd|8Q 8WX0 P80P(000S 80SqZP90SӠ 00 nSP lS0 pSP0 P0\ 0 R0 999  P0010CS;pp  JP p .0"S 1p 0T nSP lS0 pSP0 P0\ 0 R0::::0Q PP{ 0 nSP lS0 pSP0 P0\ 0 R0 ;0Sl;; Y1T;0Sڌ QPp 0 nSP lS0 pSP0 P0\ 0 R0WD<T<`<0Sl t<x<  P< CP  f0` -L `00SX0T0 H0 D0 R<<R000\ E0 84, -LPpMȠ@X 0 0S@@T0EE@T V`PP d00S  0Z  0*P 0T0鰵,$8 -LM,00 S1 20 00A R R KP 0!S 00uP 11 00CSlt/hqQ4\Q\a0L00QPɝ., (U0 /00CS0A00 00CS@0@000 0 d00 S l0 00 0 0 S@@ 0  PT78tHpܵ|X -LM60S, ,K`pP 셟,0 QU0e Q@L00זP% 00CS@0E00_h5 !0000 S<%  0!S3 %S  Q U0e Q@L00外P 00CS@0D00,0 0 0\S0 0W9 L$PU,PPp `P 00Sc3P@ T{( )d|3)pp0T` T0@@D$Pp  <0#~@p58`ܵ|P' -L@MԑP 0S S 0[S \S PqPP(0 SU  0S S0Tpc Q6@a@0 Q@L00uP( y)(00CS0@0000CS@0@00h@  0  PX00S  0o8 (9Hܵ|X$$90^S0]S0]S S [S.Q =Q:Q 0S]S  R0 S]R0]S S0]S -PLpMPP@0` V0P 5P 0 R00R00 10BSSP %P p H0"S@@*(PgR000 7 -L`  0%S0S B0S00( 0A`F0Z00SV t QdR0Lr Q@L00冏PV 00CS@0B00 0 P `0S \P0 S0`10S 04`0C$ 0Ph `1000S SP.100S Q6Q0p Q@L00/P& 3('00CS0@0o000CS@0T@0]0 H0`00ȵ8HX  ܵ| -L M0 c Z0CP, 0 0YʼA000m 00,kPpTB P`MlQ000`1@p@T V0 L P`00CS0.@00& 5#T00CS0@00$0Pph0 0bYTZPLL&  P8HX8 -L@M  " 2 PP" " (40S" 0 ?K  B!P"R 20R2 >ßb" X" ڠs0圓 X@L00"P 0dß0CS@0TC0i0 30S 0 3 ʓ "0K P32bXڰr0嬒 X@L00PJ 0tŸ0CS@0dB0-0m020S 0u2 ᎓"0S 2S  1    ?K Po "圑`e0 Q6ڄq0倁 Q@L00囍P:%P L&HH%00CS0'A00 00CS@0@00 V K 0S" %d00S 0P@  H 2S0$ĵHXܵ|<9$ -Lp M00 \, 40 0&S20 `@0 dQ胟0䓟 QP\00P? 00CSP0S0\0Tl3, 0@T0p\SL00SI9SG400CSC02 `@ 0dQ,肟0䒟 QP\00ՌPMt$ %,%00CS0z0p"0CSP0`R0 0MT?02, 0@T0p5PU+a0쁟 U@L00嗌P6$ %$00CS0<00CS@0lA00D1 00p$0 0cS< Q6P0` Q@L00YPђ# ]%$00C0S@0000CS@0H@00 0 00ȵĵHXܵ| -L`M萟䠟pd@0P1 ^, @PP @@AP@00@,A0 00g#@ <$88F$墋PP頲ܵ| -LM"0 s8 <  0s||"$pB0Sh2 d N`0V00`FBچ04"00S18{h{{{  0000 0 00  0   0 B0 L`F000000000 0 T1 0V0#0`F L`0?V`F>f 1! q004@K0 0CόVP `F pGʨ00Spx d 8T 00CS0D D<P@00,X9H X p-L M00Cs0 0` 01 R 0@PT 0@ἊT00Cs00 00,00 00p餲,0#82 P*0 4 P!: -LJmK(`F0*KJKKM4M8`F2pK0PJKKKrw1*K2P KKK 33 33|9 JKBP ({PH9 zK PE,9'7Qc?0@7S^Ѐ؀ @P`ȁ0d TLF`{P 6 Y{P K 7 60 p7l6t0 q786 6K6$0 q650*x650 q5z|50 qd6mH5h0 x6`86\E pK0 q4K40 q4>40 q|X51X40 cpo,5$$4`0 qbD450SC ( %0sZzP 4P zP4K#340S hC KP  6,3, `%L4'40S 2K D`28C0:0*P/*P 00SJ T3 K *p2K0AKx KBPcX ]KA  @>KuP `s0N KD"IU 20USM8K @Kr` nKYx20S7 "0S<0T2Q h2@0S3 <<=D4=H=\=p=====0=,= >4>X>>>>>>H?X??ܵ$̵0ص??@ ,е 4@@@H@X@p@<x@<00SF K KP J K(@<@LPP    ㋌P ppPU%JJmK(`F<`F0KN@ d|0Sr0 @0By0S yP0!00>0PU0Z!0SK00*K3t!:K0S(0S0$((zKrP0a N#R-*0[0R)‡ K"0S  zKr 0KSx2  X2K0S 0 S S  TJ=K(0C80C0S 2B ?~b0S"0SdK@0S0 2 dK?~80@00S0S'KQ \0 S0S0 sJKB00 3C ?ᮺzK i6p0 0hP+TKK00E JMK(@D4@DUXp  ^ |P  4| ?|P@0   UT ?KSp`Rp` 9pp @T_UT᳆0S,t50/>1S00000S 50S;0%0S0 S*< 0S0} S*;;005 0S (F0S +0[0 S0ʄ60S|60:10V0S 6 Q+0S  Q*ÐF0S6?P'0S701070S (G0S 0888'q00D'0SP70SX700#1ѣ10zKs*K:KJK"2pKK  7K 0^0R00S 8K YCP :KJK "zK XxK| 880S ep@ PO 8^ y]Kdh(0eC,K^KPE?W0VKKmK@S(`F]K @:K2 XR"w0SZ zKru0SwPJ  ]p@ RP !49 Kt 0R R d0)]KCU31/ U0 01 0 1  ! 9 ? !K >K   "P/X 0-L0@tP\ll l 000 RP0 D ΉP(0,R]( qR00(edA|@@h9 p-L`@PM`00Sp00@4 04妉Pp0Sp ']  FR(gd@@ -L@Mq0P(0 000  -R @ -L@MD0P(0 000  R i@ -LM @4 0 國 ,K4V, 0Sp` 0S0 40A0SS GS S BS KS MS kS bS gS mS sS T0 T 0000 85P@W0"S  I"PQ 0 40QZ Y 00 40\0U 0T 000 400Q@A BA@_0ʟ` 0Y0P0H LP0ɐY0P0)40YT0ɐY0T0T00 R#R08 `0ɐY0`0Xi80S40 ?>1 {~ (0d0 (I80S-<4S84s ^8\5z@@@@x80 80à0"!<0D0t x$W4}0P5|XC00@L5 0 "4x0!t 7\5@84p? G@: ?\z8`0F@_0 Sz0 tP@ @?S~}@}@!0 010CO` `Pot ?U`P0@YZ80 0<4/S 84S*F0\6P x@{}!}KPo`l6 x0T<ƟQ08 `TQ  0y!}KD@ !-KC>008 `T?y@0@xWDX!K 5x0!K@_0 Qp0 O!-KLE0$Ŕ@U000\x <8 @Cn 1!}K<8 `?Xh  NK`ɵX( p @0p0 O^P1`!>A\p4NK`  q`PO^P``!>pAdKK!mK lHpP`, 0 N@0 ?.P2$5P!Sx8 $B`0W30/>xX11a0P0h1G0ņnKq@`0D ?x!K`p0 N!KD@0 !]K K!K 0lX/>/1Ό1x<\P `0T30/>1 10SUS0@0/@> 1$Ŕ0.1\`0^30/>1 100 P,HL48F8Fе̵lFFFF GLGԵGG|GT,TH$DHD4@DX0< صܵ,LD4t XP@0`p0 o8 8ĕ!Kp`? ff@_ PoQPX0S@JpP0/> 1$.01^ ,`0U30/>11TL`0` x0Q0x{T0 0R0|0ఠ000,0@ř- 4@|( Œ p|h_0 2P'( 4  #@0L04 VD2  Qhpoh2:h0Hx"x2|B 2@< 2R0\E^00PEX008B0XD@HE@嬲4@ @{ ,@0H 0b"K "KKH 0WOpSL3 ` 8HxP@ @z JpT"KQp 0apÏ0KHH#0C0PPo @R /p4` @4H$ę (0 `D0S l40S9 "]K|@hih2. Am"Kd p`B000 P@08 ph@4giph/ "m`P8vz,@0 xP"\5SPord,  B?P` @B ?  @ / P PEz00 S0!:10L A0PSP1\%R001c00`Ph1 `嶃aP q 0S ,&tl 0S 0S0[ A0`P@ Z0 At s JZ@yPj UpPU) P0BNK@D0( 01>dHH8THHh:IT8I$ @I,tD4<DXTP yNK@D0+8 +P +y y0+|@V.㲄0S 00,]0S 10S 0,0ZA TD0SL  X10S/ Oy0S ~ l0\d `0 @_ ^( 0  `p( A 0(.0 P(|u2,0Z@B0S L20S Dd20S "K@@P0SRKR0S08bOB3#0 40 3rc ՃV.0SPop. 0,ƒ P3 ?wu0 F0St4  |Sd .04 70S0S4  #d3c04  s>4:4\ 0S400 0 0404080 0 B40  -LpǏ0 4Mm@_, 0 D0 K@ K<4S84S*C>0@ K-\5SPo0 %80PPcDP 0 ,p 0pÏ@0800hD0 \5,,SPotL ?P8` 0,p 0pÏ@080h,\ 4@1x\%;R+  0O  00O 0OTS (y[|K $5Sp;0娀L ,0@8  0b`0H{P3p00S x 0 0Rx xO \t0A40 ,0,0CPw@400!0 0\0LX L0T0dJ0h0/\$U>U`0/>1d00/>$* 0ARh0h`0h\30/>1d0hld 0R }%9,p 0W0 0`||)0S>!\0ρ0 >00c `V( 00C 0,XoD ZH j8 R`0XH `$5S Hȟ?>l1H 1A# H8 0R00>dHw\8 RT0!0T0  000$$8 RP5xX0P00XP d w@P"w0w0` vPw뀀 040C$ 0`780HDZH <80A`# 4'0f!40f0 Y40  '0S>!`0ρ0 >0 0c  Y$00$080` 0Y"S H iʀ6 R`0`VH $5S H DƟ?>l1Hp 1G# F6 0R00<dv5 RT0!0T0  0005 RP5uX0P00Ydpv@Pv0gv0` cvzv뀀 040C$ 0480H 0SH ğ Z j!400400$S>`0/0 >0 0c d$0 0Z$08t$5S+44l`hVP@  R $5R 101 0Sp0`@@VR 3$5R 101c3\x30S l3434 BX Cd@S4 0V04 0Ār00 S: L0 20S L  F0x S0L00 @L P \%2R`l@[P\`Vb\5"@_,Sdp ?b@P [0, 0 H+1 0\%1RL 0bu`0xQ80  `uVd1Lp 0fZ@DL0 l0@T:䀟\5 @_,d SX T ?@P`p 0, 0T *00P@8 ?u \L0X`0 VDTXI<U ,I<T@DXTT8P -LIK`P@ Md,p0SL2<0S )B4#1K@ p $!K0$1KA0#1K園 園 0S0!1KGOK"K{$14!P  -G?K`0L @P@@d_4K4 t1T@ N0S )B4#1K A q $!K0$1KA0#1K_  _  @2b_!0K0A?K00K00K! 00 EK!1K "K.$p4!a K@0 K 0S =`L 00@OĠ;CKDd 3*4 (0 ,P@DP -L@P,M00SD>U `pPD @00S0000 B4 0{0 PU4`cpBOP21F$ `j P, -LMl 0O, 0 TEd )0 N@0S  $5R 0S00@K0 Q #P!4 R`00PK@O` d0 PtT00PK`8 O0`KTSH` 0`K$4 R`0 $5SOs 1l^a1 NQ 0c@0xS 00C00p 00C0 ?@0 000000$30SX00Kd D) ?%p2 RT0!0T0  00C02 RP5X0PE00T@@ < +0PKd ) ?w@_0 o ?0 p` w ?`p0 w@` ? ?o<< < 040CC$ 0向,00QN 4, @7s180 0` 8P@`a$4 0O Z4 $/0@K` pǏP`O0  P> 0`K`0`0pO^P``1!1NpW0nj80ZH0S80 U$@ d ( 0B0 KD<U IIJ4, -L MS 0O, 0 Cd r(0 l0S ) P3R H2 00 0C 01\  3 0P" Ÿ d G(2 2Ÿ  0@2 00C0@,00Q: {X"00ɯWr<2xdr0Ÿ`\%@2dRp4 P0Ur@_ 0 p 0Dro 0@! @ 4 '`1|0 0p\Dd1\%RT!x@!0r$0SC ,9,  0(0c( #(c4"4#\(0, 1}뭩l 0q0ST ,,pp0c( #(c4"4#@\,,}닩P400 0oJD<U I44JTTT -LpM\ 00S o|0 ?z0P@ o,hh0 h?`k P@0PP z} 0" H\J -LpM\00S ?=0   og h?`/ P@0 P^P >}e 0$b LJ -L`0StH00S0 R00 #L10S0 #1  J| -L`0S$00 R0  00B0  20 10 hJ| -L`0S00 R0  00B0  20 10 ;J| p-L@PM`0S0000 {00Sp 0c( #(c4"4#008#8c4#88 8#8RC$ 0p0#8c4#888#8C$ 0p, -QL@M  P0 CQ@ P - L0R PB K -L@MM10SP q0Stt14 0##0`` _pPQ0S0S 3/S3S0TFp@U1p0_0)7pZK PE*0TP K1:Ca80!a$8#$"0Q   R 0K!*B00p0*s D8T|: 0-L$@KMzX 0PbyP@|v 0K  9EP sv0 0e8C00 M,K8K, 0-PL@M\P0 0S x @0@ T @! d P@00Xy0, -LM, 1c( #(c4"4#, 13P?"ωP,pbHlXnh@"P,`.?HXhb$lĠn&.$$"%,?\_"CnXÇCN@n?.,?>}]C>bC>,0EnPZ=V=0QE>MX4c( #(c4"4#, X4 0\4c( #,@(c4"4#P\4$4$ (ř,`xcHp bXahln@#x`' P",p`!, .Hc4$4#Xhb$alĠn%$"(,*.&!4S>$S^(ŇSN,@ m$S>0=T5c( #(c4"4#T5H%\5LPXřbaH`Xlhcx"@!P `,p#b$.$"H,aX`hlĠxc4$!% &,'4#\5H%LPXŎ -L@,M08#8, c4#888#8C$ 00#(0c4#888#(B40 08#8c4#888#8C$ 00#8c4#888#8C$  00 ` Pf8 e 0 0R$$0R:=` 00V0 R 0s00s xC0S 0 4 \3 RD304SP00 3 ` 0 A. 0000000 00 ``Ģ0A> 06 pIpq Q{Py 4S4S 4? 0 rpP@u$>3<0A>z 0 0 P001 41@ $1 P0  *l0pP  Px3e<Ph10S\1PU i1A 0O U  1 B>0R 4PU70K000 #3k040 00S 00S 0 0 00`` 0 0 0 00 ``0$$R0059L`dz`0L(z<$< , -pL@M 00s20@`4z -LM@0S|Qp0 (4s,4s 0P02D00Hp00 0 $\`Lz, -Lp00A>`0P`O f6 VY U00QZ xH20S 0SP0 @0pVU``z$-? "T000\ 0S00S000\` -`PLVFp q  V0U070O 4 6y†-4S4S' P" 4S4S 4S4S*p 00  4S4S:/90@@&A> 0I6PU`$T`, -Lp0M@ 4 tBN@>p@0t h$00Tp `, 0-LoP0 0\0 Q  0R 0RQ$00 $A> 0000`D00S000B 4 00`x@-(0A> 0$Đ6I ` -LM@$0RA> 0  0R0$$R005:N~ @0$$R0A  0@0$4` 0-LP $4S0C$4! 4S4S 4 A> 0@0P0A  0@\0$4P0$0RA> 0  0R0$$R005090h`5=?0/9P6 0S000d -L0 4B>0 Q 0P@Q0P@kBN@@P(`kH0A.p`S A>B$D 40 40   0opq hk0`z -LMp4aP \0 @00000 040 4  ` 002 ?Q  ` -LMX@ 0S 00 0k 0S@0 04h` -L@0 Mopq @ -Lp`MȀ0P@TC@!`A>B.A 0 0$D4 dD P  40 4n0 4sto"` 0-@LhP0 4 @ 4@ F 00 04T0j0@0hE`00 ` -L 0S# 09S0S0P!00 C.SbS cS`\0Q B:P/&R 0S0Q)Q)t{t{ P0-LP 0S0@0S [PP 0S`@0S [PQ000 0SA/m&h{ -LPH0000040    000Q꼗tP 0S0*S"0d0C S4444444444444$4,000000 0 |h -LM# rPP@ 0S h.P@ p P@`P@ PP@P ,KPh{| |,|8|@|L|T|{ 0t 0t 0-@L0S dd T\T#@P$T0S( ( $0 0T,l\|`|h(0 $ 0 0 0 || -L7 00 0| p-LPM-n$`000n@000p|n| -Lp`700S 0@nxPx 0 0S [-n0 0 00S$`@0S0S| 0-LH@HP 0R80 0CS00 00 00|| -@L∠p0 倀0b? t`TP0S ?n0 0b@?T0S(0@0f0m| -@L℀p0 |0b? p`TP U u^n0 0b@?TU,0@ 00c0m^| -LP00S`p @:n 0 R 2n 0 0CR00S 000, n000| p-LM|` x0RR@ n`0`P0 0R00C0m00`00S X70Sp|| 0-LPh@m`0P60mD P:00@P*0P0| 0-Lp@pP0S 0S 0S0800 P0S00| -L000S W 0-LtPt@0S 0S S0S0S S 0S 0S S 0S0S S0| -LML@00 S00 S S 00 SS -L@M800S ,0@$ 0@]00| 00x 0-L@P0S5t5 T0000000TP @P00TH0@ R 0  R0 000x| p-L`PM0Sp @T XP @TT D#@4#00P 0@@00p00Sx| 0-L3 3RRo 0@dS(|D(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((( <2 0h(2 0hF2 B00S S 00S SA00 Si00 S cQA1 Q 0Q S 0S0S S hQhA0SL0S SI 0SE0S SA$1@@$1@`1,00 @00S. 00S( 00 0h40 0h0 0h0 0hI`0 0hu\0 080 0h0h00  0xt| 0-PLP P@ e40P0 -L`Mk,A00 SSp e00 SS 0S R`*0 S0`V:0V)R@&*ZW ڈ00PU*  zjP@E X  P00R@00 R R`00@T:| -LMpP e00P@ P0P@e`d!  dE 00h0 0SPjP@RO00se00S S @ W  p-L@M,a0PS1Q? QT 00 @P@ 0R" 0R@ R0  PP h0 l0R0R` S Te P0PP 0 e3pt|d| -L@H M0S00 B0S PPhp@-P@T`^ 1$/ 0N0O /^P@p|| -L42h( p-`L@P M_iph'00SS -L@M0 000C0@l@pJ0 dF0XB0L>0 @:044500h|||||$L p-L/ Mt0p@p0@`@h0 @P T00SU@ V8 V0ph, l0|8 0-Lyu200CP*S񟗀8TX10h0 S+S0 S+S ,APd0S00 01A $00000 00 0h00S0 0hz90!S @PcN l00S0`0PXX0hw@0@T0@040h(0 ,(<t|<|| p-L@Mf0/Sjtt4p00@ S5dP15@@7pT0S=&P:$0@_T400DS/ <<<<<<<<<<<<<<<<<<<<<<<<<<0Q ,4  pQ 0@0#03 #0S[ T T0SI$K0$0 #(i003@SPUc 30T[ 30TW Pp +( 0,K(K H3000 P%P 0U03 0000uj,0(0 0S U@200 048CHP"( 0(0 0Sx20T l20T 0S|@b0@0S,2@D$PP $[#pF$P( -00K0K@K(0 PK (/0eZPV0D;SR00S 00S @ 00#0 T T 3Pp 0#0CSPp (,0| 0-LP(P` 0s0s   0h(00S P0 0@0m@00x 0-L0 R 0R0{'00S0 00S 00S @0P 0@P@w0S m0p &y0@0+P@:0h%`0%800S0%0hf0X4` || -LKM 0 0 &(} -Lt P h0P0@0P00WP 'P 400Sg SS  h: -L80S000,0 R4 59{&0} 0-LPg@@T09TT09 -LPpM @0 `  P0<0p@ 4 3PP0# i  P U/&W iP -L`eM(?0$/0?0/0?@ @0S>@ > <6>0S*/0SeXI`0SeX@e |N0S ,P P 0S#0K$K$`K P P 0(K(0 @(P\TT0DcS(0(*-h'25.$2D+p('*,+h+2.l/+5$0,\+d2<2\,))|,.'(333`1.)4@5@-p--.155$*,,1005555555555555555555555555555555555555555555555$` 0gD,0S0S ,< L0S0So;0S;' +0S0S ; K0S0SN TK0S0S0 >4;0S 0S0S ;:J0S0S "J0S0S0 :0S 0S0Sd:D:"8J0S0S  [I0S0SC90S9  3 @0S9Y@00 0S D9 0R0 2()0S0S 8 90S9k 8 j(0S0S 8 8 X 0O\H0S0S0  $(0S@00S0dS@d0m7,h0S0SF!aZ0S 7 |K(0tFcd70S m P (P0S6 0S0 0S6 0S@08F0S0S @6PF  Q 0S0 j5@Up00  0S 0S 5@Up00  0S000S0 :@.P~H5Q<5 04 50SPl4 OP 4@T4 0B4'N4PHD0S0S P; h40S 40S u0S0S440K00 4PC0S0S0 P 0S0S33$0S0S@0?4P\0S0S <4P $P4p@0t 2 d0S0S0 wP`*<2@ P P  X2 L2 @"000"04( 01Q41 0 010P` 10 PP} P{ Py 0|10P`n l10 PPi Pg je0 R @w"]0%,10P`S 10PO P P.`PH0 0%` ,,( H4 L< D}<(L\} h}T},L8}X}}}}~ ~~,0,~4~@~X~<`~ $ 0S0S P0 \00Sd00գ?0p Ox00 R0S0 00b 0S0S 0 10S10գ?0!O 1  000 41810S RH 0d10S p1 + -LP@M)0SP S0@(pP`@ KbPl`0S 00S0S00U00U@03 0ST)l~ -L44-0;((   h$p~~~~ R-L`pP  1R@T 0@0D 0 - L0S hA!@~0 - L0S h0!D~ -L0Sh#!~@-Q@000*0 SS&PP gP \S0gSf0S0S0S 0 0S@Q:d p-L@P`PdMp 0dP@TfPdp00  @00  D 0-L@PK M\000S ^P   0S00P00HL00 0 - L0RS 0RS ;  0-LPM0QES0QnS0QdS 000 0 c B0 R2;<;<<<<<<<<<<<<<<<<;<<K@K@ 00K,0@U$ 00LH -LMT1PU@[Z p`WPPP  0_pP@uZ  t@ /QR Z0S0MS0+S0GS oG oR< p-PLP` M PV (P@p P K @ Zp( -L@M10P 00P p `KWp@04K8K0F@F`PP  0@SdP 0ESdP U 0ESdP0dU0S W 0K@@DTpGW8P -L@`M `pf`00T0)ZW 0PU*  ^P@E X  @00R000 R R0@T) 0-QPL@ _ P#0)0S0S P#0Q  0Q A0S0pS P0PS@0PSP p-L$PK M@0S|`p 5 $0s 0s h0S Z40 :Y000 pTX P-L 04h -LpM(#0P !g #0S` @ BP2`W]@,K0 K0@ PPP 00S@PdJPX2@0 LJP@0,0 ?P8  8Kw8dYZ 0  \Y XYVY  P, 08K80 10S@P ,9P \8K8 yPYP , ,YV1`10 1 0p 0 ,  0P 00S0P@0SPP 00S00 Z)|0U h00S8K(8 X PD}< HTX0D$(L -L@0KPM` gf8Kp `@PU0?P P@X PUk8@0P`` 0  & 0  ) -LP`pWڽ`V@ZP PT 00 , 00  00  0-LP@P@0 P0h -LM@PP p-L@MnPs`mPp U Pp V Pp R -L00S0S  Ch@P t -L"ph -L`MR@r`s@T10S O0$` $Kx=0A0Cl0STJXIXIJXIXIXIXIXIXIXIXIXIXIP0ST T TT<  -L`M410S (1pW ; #PP* #FP% 0|SPZ@}Z@@@ ]$PTU X 0CH)K 4P )[P@8@y0S<}  -LpM00SRc|P` 6Z@3Z0@/Z@@{P 0@hTT iC<Ȁ -LdMpK@P@h0: S@@PT 0-LP`M@0StK YFP0SjPX00Sl0: S Y*+PT0 -LpK@dMPP<0K,W00SU"E"P 0-L`00S0T000~pP@u T0U0 0000,  0S00D -Lp`P M T, 0  4300CW $30S W300CW  0 >B00 S2  200CW]UV sF20S 0S 20S !! "UVP V)0S S! !20S  pWZJZZ`P#p`Pv0X,0 pCqAP ,PX1AP00 R'410S 10S uv00S 00S00S0   00S! 00S 00S!pWZ00S0   ,0S 00x 000 Y0 Rk$0 ot |xԀ  , -L@`PMpTW 000CT0 @T Jp`PvY ~Z n@TZXZo+   -Lp` M(10S 10S @1P pP@+u)V 0AP 00S PP@ 0pP@u a0 000 0X  -Lp`MpP@uV i: 0P<00S,00S 00S00C`\x' P000P -Q0L@ 0 0 00 000d -L 00 00C0d p-LP`(M @ 0  000p P0-L@8P0 0TQ0hQ0PP0PP -L@M0S00d p-L`8PM@T BPp @Tp 0-LP@P000P0000000000   -pLP@Mu) 10S1!00`Q0 /%8P*/p@ P@< P00 P80pt T   P 0`V00S00 P``V0P@` P@@P@4x00S00 S 0 P@ P pP@l,`d -pLX MrPp20S200QPW0 $P@P f20S ji@ T T10: P@ P p1F@0`PP` Lx!0$x P@ p3`PcP,  0,0 @6PS+p@ 0000  0 P` P  @0Q P 0Px00Sl00 @,@ s/@0PU`XW,f  ld,` p-pL`PMv Pppp P P@0P`40`@0P`p P P0`p -LI0SL hp0 s$0  0  Bh -Lp`MpP@u P |00Sh0 tW V 0P@m(0 f K!L$ -L@K M[ O p-L`M6pP@ux+pP@uPphz UT0 phD`L p-L`P@MPP W P p P@$00S. ph -L`P M, , <P,0@cT @ dxP@ Hopw0x00XW0A ,0@T)y z  V0 U0 1,0c@ 0;p`Pv ,0@T , 1@,0@d0@ܠ0,@0CT Tp`Pv XW  000S o50@0CTm D0@@D 0 @0@|  -Ld` 0S 0 0S<00m 40  g 0+0 頁,1hl -LM⠀0圐pN댠`NP00V@@TP P7NV4N  bS  bS`PplhL00SD0 <0 80 40 000 0 0 0 h  -LP@p`M0Sp`10S, 1 00!q0s 0SQ !0S0S|1 0h1 00XD 0 00 0S+8@K 1rSa0P0UP 0OPP 0 0P00 0 0 | 0RTL0 00 D00 000 0S0thh p-L`P@M0SQ0SPE P P@P0SUfp0SQ 0S0ASQ 00S00S  -L@p`P 0 l0T@lT@S   0^ࠡ0nP 0 000l0  00000nP0<0 0n d0 dh@P U0  0t 0S SU(00SPPUY 000CSP꼬xdU? U BU ? 0 0 S001U- U 0U -10 0h100 X0ESDU U U (K, K,0S 0 000S U(U 0W000CSXXp00100$0 $KU 0  0  $@lQ PP -LM@  -LP0 0S00 -LP  0   0P$ -L0KM0 R锆 -L00h$ -`Lp@Pg`P0SE 0$S T; <P80 0C$S'00@f  000S p-L`P@ M0-S 000C S T00pU KL P 0 0 B0 R0CT00\ap鰆 -LM@@0S  R 000 $0S h`0S R 0 <000 048CP$0ShA0@Sa @0R0-P00 -L M@a0S, 0 4 8 < @ p8 PU(  oP@P@  T0000<0   T 8P <0 BT@ 0 XPU$0P< R 40S4 000 R,  00 80S80  h -LM< @ D 0 S8K  08 4 0 , |t0D 0<@x\0 R PP0D000 400S 000P,( -Ld, -LKM3 p-L`MyCPsB@pB@@ 0@Op  -L  M0KA 1@ _P1$a0d  4P@00KT0d  U0K 330 3 -Lȟ\ 0 p`MP@ p00K 0 3p`V0d W00K0d 330 op` p-LM<10041  p@`-0S! 0DS     4 00CS HPXd`   @T U* 7`KPP0DS ȸиظ   0@p, p-LMD`DP0@S p 00PZP0  PpP, 0-L@8 0S0P00J  0R+0@00P+ -L@MP P -p`᧯LZ)KM `vp00h0 :0 P@0@@h3p`0Z-00h U -p`᧯LZ)KM `vp00h0 :0 P@0@@h2p`0Z-00h - -0Lo@p@`M 0K PK #6 000e86P@V-00e -L@K M{@ -L(@K Mo@ -`LPpP' %P0 `Fp`0nS dS sS@PP 3PpPpP -L P P Pp hr -L`P@0p  \  00S Y z 0@0 S @ \00ShLu D000@000T(0 h$T 0-L@P( I xR 0 0h p-LP@M`0S t00S ]0S@  @00S(0 0S0 p$pT00C p p000C 000C?001,0@-@ \40010\00 010,0@-<00 CR,0010 BR0 000,0@- 00R0$001 P@R00, p-L MP` 0R@p0$ KS ]: 00$0s 0sp 0 01$ Kp0,0@-P 0S0S0X@0^! 00S 0SN00^0, 0AP<0!0s 0s  P,0@-d0\X0!0s 0s 000000\@00, 0 PPPB@ -LMdw`@0\0rPo0H0k@0 8f40 ,a(0x8xxxDyy p-L@M ?@`P8 0S BPl   0  p -0LKM0K00K -L(@K My -L(@K M -L @KM -L@M q0r00T00S 800T@qr  -LB@M6P񟗠htt (4hHPhh1 1RM10Sx1t1#l)Od1X10S@5 Fpq0 P PP1 dp@q )QP@@ 0 SPw@@p q  P(0P4  tD p-LB@M6Pl<$lpP@u3lP@UʹP2 R@0`PP`VUP@UʠP2  B?@/@0-H2@2P Z 2>V+P@@x_@0`PP`VnUlP@UfPdphd P20tP@<t0 u SRBP@0< #p0 s5  3 }0 S-P+ph6 p0 s ph 0Sp0S Sp00CS0p0S Sp PHH00wP phphp@4~5 0:S S@.S ?S  \SR R 0-LP@0P0C Sf<TTTTTTTTTTTTTTTTT<T<TTTTTTT<TTT<0B0C2S=,HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH$HHHHHHH4HHHHHHHHL0 00 0PE000L -L`p88M0S( @0:S %S .S- ?S \S ;$PU $K00!c(@~PD@PU@D $K00!Oh0 @V  (0S P W00Pg )40 -LH0H0 D0<080 400bcA 0 D(0$0 00bc0Au -L`0M8s0P PH@K 3 S10S 00PW nP; 2P. P2}KP+ zP7 P/ tP6 KP9 o PT d2PA KP9 eP@ K PC ` PO K PG Z PN 2PP T2   N1   I1   D1   ?1   :1   51   0t1   +`1  &L1  !81  $1  1  0   0   0   0   05[3[-K'K*K0<D 4@[G x 0@0< D (0KH @ͲH K` 0<p( -L K @KM(0C$ 0g` -L@MP  00R0R  00ShE/ -L@MP hl00Sh/ 0-LP@P $00S0h`/ 0 -L K@ MB9P 8#Q0"Hʌ P 5t0p` P00TT0@LP "400 PP00ht@px| -L@M8A@ 'PH,4DLT\dltKuxtplhd`KeP00 00 00@ -LPnK`F`FM|E5PK@P.P00XP00G@<5 405 ($0 0u00 5 %PP4 R4 4 4 4 4 4 4P4(8 4P4  P4$0P4$040S x40S hd4 XT4H$004$0,$0S40$0S30DP 0S#00300S3 P 0S#00l30P 0Sl#00t30phP 0ST3  D#00204C4Sr ,,0pp`#3P`"2P` "2P`V2Pp#PBJP 0S20?@0T@SP  *((X8(800(8 0"("00@X0T@SP 1  B*((X8(800(8 !!00@ T0@aPPPS@pX100SL1  $$ h& hhpDC0X4(/8|<x@T20DH)LPTXl0H.tx\p` 000 -LM0@ 00) p-L`PM\ 0SP0   \ 0S @Tp -L@`P pO00S000 E0S$0>P000 -LP00SH H0D09) <00S$ 00 00) 0 h -LM\@0S P00SH H0D0) <00S$ 00 0 ) 00h 0 (lh0 0 (ph 0 (th - L00q) h(xh 000S  0(h00SP0 0 (|h 0 (h(00S 0 0  (h -Ll000CS ,< h:h(ThBnh\ -L0 z(0 h -L0 k(0 h -L0 \(0 h -L0 M(0 h -L0 >(0 h -L0 /(0 h -L0 (0 h -L0 (0 h 0 (h -PLp`@Q-  00 000000 T00R00S@D 0S 0S ZP0S00Q&10T00S 0T S@D00\00SH00S800SSS00S R (0000 R000  $00S00S -L@M00SЀTpW0000S$ꠠ0`0CVP@tu 0 0S _0`0CVp -LM0s0s 10!S@0oq00Sm@0`0CVpP@u }XWp q   Q0 P0  $ 0`0CV -LV0S, ,h0S000hW40# -LpP 0 R  `[P /hX@P`H@P/B5j%PM0p -LM@P0  p-LP`@ M (0K l0 0 T\PP (0 00 p 0-L@PP @4/T00 0 00p@-P@ \`p0s 0S 0S qr' 0S$P!:00SpV00Sp0\ 0S 0S qr 0S0S*p\ph@-0S  0S 0R0S ^ 00S0S:@T 0S 0S 0R 0R@.@ -LP@`, K M00 ap`PW Z 0S0 S` N Z  0S 0 Sp`B ,0S 0  S0,0 P` 0S @0P`, P, 0S,0S @0P, `00,  0S0S  , @0 P0R`S0RSW -LM\S\@0 < p @0R@ 0 jP0jo/@0 `<K'0Sp0Sp @K 0P<K 0Q<P 0<0 <P 00S0 0 VT -L@KM0s0s N0 Z -Lt00S0 h -L@MP  QpP@uIP@0Xp W``P@,0` WP@  MpP@u|00`VpP@u p u `VJpP@u L -L@@K`P,M ^@K` ph200<q8 r 08@T <\  Q R`( 0@0C 0, K `P @0  ` P @0puv R@0KH10S D@0dS0c S0 M@, 0K4 K0,q,#0"0P00@KS`0P00S Q  10H0  4  , 00@z00CS0uH00Sr4, 00  @@TH,t -QL@PM 0S!%P 10,<R A0S" 0S!0S001 &q0S`  PT1V` 0S  41 A 0S 1 0S|  0K(0s $@t3M K>0 P PP h0 P00R00SH0  0K 0P ̑TL -LP@p4Mß00KP@K   R0S `  D `VD r0s tu h20S R0S0S *tu $200@_0 K0tu 0S0S*100@_10!0S0S00 ?SRp00pWÏ0K D1t u  y0z 0 U T P @t u  U0T0 " 0 @0K@  Pl q0s  ,0S00S0K@0K0 K0@ K 0l0@-P@^ \ \ 0S 0\ 0SPT0^0 -L(H/$$0 0R00 h-x, -L(5/$$0 0R00 h, -L("/$$0 0R00 h, -@LTML /D/< //.h.x -LM,1X @@ .)../,.u0  @`PpS0S0S 00x ?00 X0  T 0S H0S$08   i{,, t -LT@MQ 0   0R*Q0 0 0  -L`P@MAp/; 00X00 /- -LM@jP dP l^P XXP DRP ㄧP$,4<  -L@MQIMP hpxhDTp000S 0S  -P@L@DMT@D -P@L@DMT@D00 -LM|204 l, j,)Y #H0408/s(2[!Sp 4 &.Pj( K 0"S 0R0 R00S` }, p0SX S S  ," 0 S S S,2@@,2 g, 0SC K#.Kn02SPo' ,"," `P0^S0,2 ,0S S 0\S0,2 ,"0,2 0S S,"0R$S@@T0B,2  ,2 0 4@ 0 0|00d 0_K ḉP@ 400S,0 (0  0 g00S$ -L  M`P 10000   , K p @0P`yz000S 0 L@0i.04 ,4 Z-P00S ,04 P P@ @,t -P00QPPLUp@M T@@"@2P 8R. 4PP 0S0DS $,4<aaaaGɏKP@ @0@TO(PUN 61@T X1U-$ K01S S-$ K0ACᾯ PpK/K3>KP@0嚐, ?(@@ 0 0000IoK ῈPp0U P H0 h0 d0 P0PH0 80 gĀ3,`QP0L Q000400S0 0d0S P0PR00C 0 800S,0 0 0 00S  } p-L`PM\ p2 000S 0 0Sw 00\ 2 00 0S 00Sb !000S 0 \ 0 00 \ 0 00\000; 0S7 00\ 0 00 0S( 00\ 0 00 0S 00S \ 0 000S 0 0Sp@@00S 0S 00S mPpp -Lt P00L0 -LM@0 K p P 0[S0 0KP [ 0 0-L4PK@  My$ 2+p$@0i  0-L4@KB4P M#0K$K^ +p0i  -PLp CMMH  p,[ 0   B^KPEPE"4,0)4K0,4K0(4K?0@'4KmK0&4K`F*DK`F+DK%DK",0)4K0 +4K*DK,DK, HPU 0 u \PU|l#\ 0@#@[ 0 ƃ -LQ $ Q Q $@Q KQ T80T84 04 R  0S202  0Q2 Q   -L@`p`MPPT1  k,|KPT0 2St0002Wt PT0L   PT ( 0j$< ,L -L@ MpW00 K0P`txp0 8#h"XX UV TJ 2" 0 180VV>`1X! 0 180UU2W002UVMP V"P` jUPP| wjx5V`UPPP  D`L)P  <PZ`YPht@| l<|p| 0-LPL@0 CR 0R ^ 00;P0$ -LQp` M , P"11   0R 0,0 2000PU20,0\2000200 0@A T 0S @T   0R 10IOT P@ i000 @10S@1=0@AU%PP0 000P0U7 0@PPO0U*0Q0 0b00@P>P0PU * 0@PtP00U: 0R 00 @dP , \ AP 0020t0@A01dT 0S @T , YIO,| 000 -L@M0@!R 010CSNNNNNNNNN20 30 4050607080900@ RT R000 hj -L$KpP 0KM@`_P$0 ;P@$0S u Pg NP000S0 @@@000 0-LP@AT 0S? R000 #@AT,1KS0 0h. -Lp<`MP P@ hU P P h PUXV ` -L@MP R00 S  P -L@MPh -SLpPM) 0R( :_Pdd00d0(z R0  T! 4]P0T8(0 0CS(0 *(K`P(0Qr: 0K,0K ^P rf 00Rc: 0R( "y_Pdd00d0(9 R0  T! \P0T8(0 0CS(0 0K,0K ^P_U@@T T8  0S4 4 K؂PJx0P0tx ˂P? tT8x P T80T8#1  0ZP 0T8  T80T8 fT8$pQ; 4 +SPc{he{000wP騻$ -L`,ML H L |P R 0L1!0 Ll^P{05P00 L101 0 0% 0 @3 Q0K00P0SP   XL101 00 0 X X00C S 0 :X00R00S 00CS0  00:X  "X00R00S 00CS0 0  0 S0 S0 5 B 0}R 0 X X 00CS 0 RQ 40   PL|P0S[  R R00S 90, KP,0S0S 0 X X  :X00CS 00S+ 0|Q' Q% o Pp  A00 Q > 000 00CS00S.9 E0BSPPaPahahahahahahahaPahaPahahahaPahaPahahahahahahahahahahahahaha`h=180  0R8  0R 0pSlS +S -S ^S #S0 0` $ $@̟<00<<0000 5 P ?0kS sS ,Z*0 0C0  d< 0.Z 0cSgS rSQQ0 0j 0 B0$ $@˟;(0 @ Y ; 0000   ;R40 0Y 0x;R H0RY 0  0 p3h# 0 180SR  J~*Q0<S 00Q0>S0S 0 R00CS00 0giP[p RH<(0 *>RH ;(0 6>RH:(004H (0` :Q 0 40`0L0P 0d0h 0402" 0 180SR(8 0|0<C|0}4 0#10 00D) 04Y$)<p0\ 0\ Z?\ K>\^ R 0!S |0< BC }|00S 0 R R00CS0Q  0+S0ApSPp @p0, 0  X X 0S7SR7S:^WP  R0 B  X X  0 B0R0 0pg0rB\ x0\ c>\'0S@  \X0SC0 S L101 00 0 X  0 B0R0 {\ N>\-0S,p 0 X X  B0R,0   !X00R00SZ \ ,0SU RS 0 RN 00CS0G->\D0S 0 R R00CS05000|^ 8$$ $5(0  R  B0R0   0\S0SC0SA 0 B0RQ0  R 00 SR@B 0  X X 0S7SR7S:uVPQ 0|S S,0  SL101 00 0,0A 0 |X X X05000C0 0 B0R0 0@0`0j 0C B@0`@R|8k`l mk m m mkTt T pT m'0 `0 0KZPk00S00d@0 L0d0P0h0Vl d00LT!MT0S700`0l@ lZPG0  l R0d 0 0d00 0h 0p ,`0S (S&0'`0 L0S  0K[ZP!0 RL000d 0l d0l0P0h0p0d l00`0T 0 S 0`0L00d0L3D#0 180L00l00Khp&ZP0 R L0Rl0Sl 0\0 0 @0S< !S*Q4  0!S0|0< AC }D̻8@88hHL\ܼ4TQ 0 R R00CS0^ 10AFSopphvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvhvshvhvhvthvhvhvhvhvhvhvhvhvhvq,rhvhv(shvhvhvhvhv@shvhvhvhvhvhvshvhvhv v^ 0^S +S #S -S lS pS \00\00C\0080H| (0,HB<}(0| H|0( ;C+H|0( :C*H}( |000C S 0k^i 0.S +S -S|0 0=S ^S|00 W|0@0|0;03SN|00C$|0}   00CS0A00-S+S ^S #S1ݮP330 00+| 0 0CBQ0}| 3 000@0+S+R-R-R|00 +R|00C$} |04K8 K 0{P4P00S80 0c c 0aSXl0dd000Cl0|00C$} |0 0 ,K@ KD0KP,0SqD0S` @Q tXP_ @0T0^ h5 \0  0 0 B0 10^80 @, 0  X X 0S7SR7S:SP 0S0C 0 00 X X  0 B0R0 8 0b! P0S 0 X X 00CS 0z0Sw 080 @0  X X 0S7SR7S:SP 0S0C 0 00 0 B0R0@ 8 0b PI  06 P0NS> 0 C, 0oSH$0S5 H$0S)Q0 0VσR 00T(>_0S0S 0 X X000CS00SሳP 0(0_`@T! T2lQ 4!yWP|0#1 0KWP00l0 ` 0[dQ   4  VWPA 40 ! 0<0  `0S Sl0 d0SL  RR S0PP L0y  00 L0@0 @ K'0P700< ^P$,00,00S W   0S 4 LT8  0 SL |090 0P0T8#1  0NSP 0T8 LT84;44_0S \Q L 0aR+0S13 303:VP , L0\ 0L00 0S- L\* | ,B4}0| |0<C$} |0|0 1! 0 180SR @  @ K@ 0< !W, 0P 0QS QR 0S7SR7R  RP 0B000B000  g00  P30504   0|P@Up P0S|||||||||W4.p TL.@] PUpQ4  ].]  >^ 0 b0S70S, 0 0 X X 0S7SR7S :QP R0 B0 0|X X0S0000CS00SL| 0R /\]hSP0 R]00,0 0$L,(1$鈽 -L@`pM0S00`0 0 0C2S񟗎 ,0PU W lUPl0 0S0 Ad0p0`0 phm0pPU W `0S S S L0P d00h l0d P p L0l00`00;S`0S S S  d0h l0p L0P p0 0 B0 .0 K40KnPP0S40S# W8 `0S S S 0Kd000Kl00`0l d00Kp0S80 W+`0S" S $S !L0P d0h `p 000 0l0d L0P l00p `0`0S d l0S* 2\00鸽 -L0@p`M00P0U60 0倪P  00$0C8Sh PP00070aTP0 0 B PP0 K,K070 0;wP  0 t0000 0c c,00|PP 0R70$[P 0ZP0 0 Ba  R0/S?S p${[000 B0 @$@4/QPP,T TL0000K0 P0000pΠ00P0000 0c c #00LPP0U0 SP 0S PP D3 000+000 @00 P 0 S S  @0R0  0 S S 0SP 0 2000+R -R ^R|0S00L 060P 0 S S  @0R0  0 S S \Y  000+R -R ^RK 00 000+PPPE0L 7 ^R00-R0S00 L 0 K,K 0.vP U, R1eS ,Q10eS* R 0 ,00 ZPcP0a0c0 0SU U 0eST 0S* 00000P $M < -LpM484|@0T0  000S P01 P0 Px -0LA0S!S0 0P 0P00鸥 p-LP`MT@0S 00\ pPp 0Sp鈟 -L@MS   &Y 0SQ ?R\d\ KQP0S 4 Y,  0 X鈾8 p-LPMx@T T  rP!X pt0 00 SX1000_R @`0 S @T` 0 ST00V0S 4 0aS0.ST` a 0pOP0T @T` 2@pOP"T@T`@4 WLpTPP0L0" P@ 0 >$"20# $8H 0[A>]}0  1! 0 180SR<14!0`K 0 180SR@00` `#:P0@T 0 pOP@TWLpOP0L0鼗$` -LpPx R(0S 0S"A0  R(0\ ( 0 P2h#hl| oHP#x0SA 4  $P 0S@ ~0S$y4:40(0xSP $!Wt`0S@  erP 0S``$0(0)AP43@4(0AP 4 0 0C$ @0}0 0$0 eAPT(00(04;4 -L` KpMk0S - 屽 P@t00@P }000 5AP U  v "l @ 434( $4:4 p-L@PM( $0R V'0   ( 0 PphS| GP`(0@P }0 0$0 @P p( 4 B;4( p p-L`@M$0S SV| uGPU$0(0f@0S  }0 0$0@P43;4 p -L@M$0S!#V@P0S`p6  (0U008 0` BV`!#*W ( U 0  p\0T0! JP0T80S b$||d -LQp`MxP@ U TP V   qP Pt`0S  pP 0S00 p-LP`M@$PA$0 x0t p -pLP`@2$ 01 $ 010$0!0$0Px0t -LP@P`$M@Tp T8  K" <, ;pP, 2x0 S*tx 8 R 40#S%S !S48  B4 8 Ve@@Tp t0UT8x <WT8tx 0mPM tT8x tPP$4 B, h1RK80S0.S6 P @~8 PP+:< P%0,@0 $ 01X@   X@0/S /00 $ @00 $ 00tx EPp 4$4\,8 ?Q40c 0弦T< t0  -L4M4 p< 8 @0 4h3 04 !80h3S4#%4|3t3 04!8 tT T /T0P P0KP0<K0T P0 0P 00 ,0 L H P4,#P08PD #4 pp P (4"PD R ֭0p{,0s 0{,]0{,{{Px"L0Tp4T `2Q`,{L@`=H0S54\@4@T t0LQ< 0xT(0,ST(tx 4vkPM tT8x t<K0C0CMM< 008 @ D( 88 ,8 0PK@+P<L! ,@(pP P 5< !kL0pJw,pGw8pDw4pAw044,4w82w@NK0@DD   0P< t0PM0w4w@(,L$偨88@< 0z@(D%W(@4g -LpPM`0S4 "LO0S  0 P @@,@'P 00S0, KPw 8 0L 3P0< @0 D  4 0 00D0 P0U00  0, 0 @` > 00KPP Z '*T0@T(!K4|  , 'Pp`j'P+0S``0S00`00S0 D R P0 L0 @08 0 <0 0Z Y (LT -QL`MG 0 S S0 S S 0S<  0R0 R00S40r R@ 0R 000 R 0R0SQ0 0V?>0!@'K0Sp S S0S S S 0S8r"S R 0S 10000000@!R 0S RR0PpP#P@ J 000 0  00 0 000p| -LpMMD8 傎KHH X.K B\\,0K B 0S  \04 0#0J080Cs08  XP  P4  00C0S0Ӥ0ȧp P0P04 U U U gPH L ~H PUʂK@  @-P@U^4T00P@@TUPJKL >KLN0C` P(Pl@8SPP`<L(0WP@; <((R 8q<8/  <80<8 <8K  c<8L H8V 0 000  0$`R0 S @@@D000080Cs08 _ M  I0 0  00 00 J  |<  -L`pFMM(PQ MK@D0l p倴K⩼P 00 `0S00 00S00 p-QLP`M 0S P@ p 0l \pP@L0S 00 0Sp, -L@M_ h -LQ@M0R @T Q @TT0p ?IP> P; K R00,0P r(Pom8 p-LP`M@0S ( Pp0Sp p-L`M00S@P8d 0  P[@TpXp -L,K`pM @T0 P LA0S0,0  $A,p ( -_0S  W'0Sp,0@P L0P@c p-L`M<@0SP  Pp 0Sp 0-LP@00C0S0 Ӥ0ޥ r >R ,000CS0˥>P0 0>R00CS0 P0 0 R0 -L@P M0S 0 /|0d`lpQ 0P  0Pd0$KL0@P L0$ SL  0-LP@t 000b0CSBL|                R+堲P&0h. R唲P0h Rh刲P0h R<|P0h$ 0 .0 0-LP@1S 1SD!GM@AT 01 000#1 0 SA T0! 4<P0T8-@T0@AT 0 000 0 S  T0! e<P0T8 @T0 AT 0 -RLP@MQ0 0Vσ:0 00 `V PPEup Q0 0V:  0T0!PEp <P0T8u `V $ -LPpMx`V V 0S @ 0` 81P@1 t00/1P@ t00`80   0i|M8P }0X 0a1P4;4  -LP`p KM@[0S 5 寭P  T    0 `00 0 0P4LC$P L0 }000(1P l \   @4:4($ 00 -L @M0S 05-00d0K0  ?P0   0l8 -LP0S 0 -x`V& V#t00  @aPp 08 00C$ 0 p 0L400>L -H -LpP \89p,奡P H @ @D0@!.,%p PL@fPP LP0QD0  CY0P0PPP d |00S|0`|`l0T0 |00dT@XiIy0T8#1  08P0T8 R000 LP\P dHK D0Kd:PH@0KP8K0谠P@0 0 DP P LPUL^ ^@<@Q 0HR  P @ 00<0S0<TX[ d Q-LpV Q   MC0|`V@ P0 : <@<0T5 0SP-: RX B0C 0 0 "X 0CR 000<0 RW 0S  0P0R0S 0S W@@0@A.K B BE/p᷏P.AnK `F?P' A.K B B|ET` :T  0p.A$4S U  R t0VT8<T8 fT :T p l h 0A 4S UP t0WT8<T8 F8h -LP`$M0S 0 'dpT9Pp$@U@@T T8  ( K"<[Px0S tx <[Pt0Gl0T8x ?t0000    W, 0-PL@t0}0 00*X R00 t !@0X - L0S0 0%t0\d 0  >h_>x -L@``Mx0Sq St00p0}0|KñP t1 pi/iPPX1 ?@ P@0@i9!0XP- 0@* 0XP# 0@  0XP 0@LJP 0@ᏛP@ @  `0?~0@}y @0?< @4 -Lp8@TD` L  0'S 0 S :S0 0L 07@TU@@T T8  ( K"  4K  00K,4Ph4 ,0R0 , KEXP] 04  4D  04D P D LL0S 08@T 0'S 0 SD@T 4P5pGwU  R t0YT8<T8 pD0L L0R0P0 08@T 0'S 0S:H S$7@Tl0@ 0l0 -L220180S  <4` -L < 0-LPM0S 0 #X0@` <0 MPKh5PMP@ <0 -L`@t0pr.| .PU&^  0 0CĠ0}0 0$0'P4;4  0-Ld l0@PM|ˌ Ƞ,Ƞ5Pp0l P0L 0 0-Ld l0@PM|̌ Ƞ,ȠPp0l P0L 0 0-Ld l0@PM| Ƞ,ȠPp0l P0L 0 -LP$M\p 0 "`VD0 00  1V140 ,@K  04@ 40 K0P8K 40K2P8 R |4K pP0T8#1  00P0T8`V?B $ p-LR@ M`0  0 KP0T8#1P 00P0T8   t K0PP p0T8#1  00P0T8 +p0($ -LpP@M20 0 " 0 180SR P K0$ MPC(K$0K =2P9 `K0$  8P.$0 0R$0 0a0^ %P0T8#1 0+0P0T8 H 0$ P@ p  -LP M8, 0 0" 0 180SR0;0J 000 18|pt ,0@ T,0 )0 & 80W @`b*@Dt_  R b0T0!@D S/P0T8L80pWE*tBT0 0Vk.T0 0]AY.@0S80`V*Hp"@Dt 80W@Dp<  R l0T0! /P0T8tpJz00pT,$ -p-LP0@4 4a✀44 030 S`4$  R"p -LP`pM0S@ 44 S44 04 Q44p0SW -LM@4Ĕ0\4  044 p-L PM0S 0 @|0L P0Q d0 `K @@`HP0P0@ 0L0p 0-LP|0Lu+0Sy P 04T+,$0 -L`P|Mx Q  Qt0 p0!Sp3h3 0180S 0pH l@T $Pc  0R$P\Yy 055:Y0 xpUPx0W 0 i @PpCt01'P 940  t01 D巌  t01 $04744 0P404 0 % 0K0d t0101P@0@004LPP gT 0XP x0S8SS 3I 00t 4 8$ "  TP@ 0z 0@  040C$ 0 04 0CĠ00  *t00  2Pp K@GP  0:0:)S  S@@T  8t 0C8 @*Pl  08 d0  K@4d 0L0 R0LL08xg< (\ -L@`$Mp0@0 4 0Q< 80 . R0 T! ,}-0S0T8"YU  < Ph8 ,,0 p 0P7@,0@ , K0Sd 0@&yP" RY40 K<@0P b800S T  R t0UT8<T8 PD04 `9MPY  <0h<  0-L@Mx 0R\t00K 0LP U4:4 000 -L|00 S S S    Xh7 0  -L@0PU `p!7< 080 `0CV`!#*W ` 0\PpU0  T! ,P0T8 0T8#1  0,P0T8 7$ -L@M4H 70 x0S sP0P00 -L5 `MAPPcP@ 70\0 PP0p `00Tp `0d&p! 0pph! }pP P CD!M7p,bp (b - ) %믴 bǴĴ b|3t0 18@@/ P 0T h0$8P444 T8 0T8ht@H (at < -LP K @CMM뀠( K2 4 1 4KIK @IA 0PD B~KL pGaP pa !](0K gaBnKp`F P!O !JpV@#* 0RSR7R*KA \\ A 0/P0 h< T$.P6@T:T@h !pW P 0KA=aP p P x c6KA A.P@fT$0@-P ^ 0D8*x1 -L`,KP$M.P0K4K, 0,P8K04  0P0 80S-U@@T T8  400pSZL U@@T t0W4@0T(x0,ST(tx PP tT8x tp=Pp|#t30ANK1@D80x  0ĕ, ,  0 0@0 474p -L`5P M0 , @=P ,4 P 0,  ,\,4040SX,dU ,_8,\,{덱p P <,!2, |3t3 0,0!8t/P ,|3t3 0, !8t,|3t3 0, !8tl 00,|3t3 0,!t#,8 403C,0  0$W -LpP@`M K˷pz0S !r2d  R- R+ 0S R& 0 S S0 S S $ K6`XP Q (U$U010#!@!@ `@2"2!4/ V+0 S S0 S S $ Ki6`* P010#tP[Ph @P2$0S WP t0VT8<T8 T@@  D- L0S  R0( 嵜h8L  -LP,M0S8 <  0 ?3# 0 180SR$18@d l0@P8 t000D 00 0<S>S3#01D0800D0D0 0D 00 0<S>S U@@T T8  ( K"400000\X0S0p0` 0  { 0S SS @ \S0S \S @00000SQ d4#;  0P4 pf0 P0 P040 0 0S0  S S@P000%S 0S SS  @0 Rp` R ~S0`0 R` RU@@T T8  V,  , K0%J Ppx0Vtx 0JPf tT8x @>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>>@>@>t=@>@>@>@>@>@>@><@><@>@><<<<<<<<<<@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>@>=@>@>@>=@>@>@>@>=@>@>@>=@>=\00\00C\0RY`K L 0S0B0 0"S y/ Y/ -Gl0  Bd0l &P(l+&P# 7, 0$S0000K0 0 0S000(  0! {4#;{ 01 @ 00 0S/00ST 0 4 0S (A,Q00 -ld0Y L1 1 H1 1 D1 1 0 0T8#1 0"P0T8  0KPKP#P0ST L\V@LAT T8  0SL  =6x0P0tx GP ttPT8x LQ V@@T t0L\T(x0,PT(0tx GP ttL T8x KPP@Q 0UPpcS =~S ::P2H" 0 180SR.P2H" 0 180SRP2H" 0 180SR 0P2H" 0 180SR`VpQU@@0T0 T8  P, 0, K|CP x0P 0tx pCPtT8x S %~S "TP @FP2H" 0 180SR #P2H" 0 180SR( $\00$P2H" 0 180SR r0@~0P2H" 0 180SR\00@00 `Vp0h0PX -LP@ M@T P T8  0pS,p , KBPp x0\tx 0BPtT8x K 0KL 0P@- (R 0/  000 00 0 00  0$P0 0SP @@@P TP, 8IP 1x8 -LPሐK`FMM  /R  P/ }K@pG TP  0P͈/00  P0000a ?-L`Pp@T*0 ST  DP`P0f?@T*0 ST p-QL@P`M* (Pp pp T*0 ST:p p-QL@P`M * Pp T*0 ST:p\Q*0 S S \ #!\Q*0 S S0SQ*0 S S  -L v -L`0pdMQ 0 0S@ 0S00ᷴ 0ヴP@Q 0H0S0@L000T8#2  008 L0@-YP0 0/ DPK0P"<00C S pTl`~````~00 B0> 0S 7P 40AShHHHHHHH HHHHHHH00[   R 000S\S    0 0R000S.S  R00 0R004 0PP 000 Z d0 KPXPx0 PXP0 `@000S0PPPb 0Rsp 0Rli "  Q*00 S SQ:Q00 80[00 000CS0 0 ä0[ ZcX- Q* Z (:Z . 0Q Rx t 0t K'7P@ x  x0d0 p0 00Q|000 0QLP "| 0@ T08 [000  Q Q08[ 00$ p-L@`PM=b 2" 0 180SR lb gb phN$ -LpP@`M30 180 18 T *00 S @ `@` V:@D@``  `0S`@f` 0\  0x6P 0X`0 0  X00T 0  @T00 -L$pK' 0`MLP $ PPX0<<X00404@T :TP0 P040I0P0$0L0 -L@M84,$$\ -L`Mx R BPk R|t0P100001000App00S  喅P@0S W 0 W p1 00000 T 0DN@!T 0TC@@0 ?9T! 0  [000K,K0 0000/0K0 ]0. K-0K0 000S0 K0 @0S 0T8#1  0}P0T8 鈟, 0-LPMx@T^ Tlt0 0S 0 -00@~T]T[T0S~T 4$ 0 180SR0!,1"\ R0 0V/ 5 0  R R  )~T 4$ 0 180SRt p0" Rp@~T0T8#1  0P0T8 08ܵ -L@` pM P0S0L l0@! ``dPhptx|0<C$} |0X鈟@-00 t@@x 1 -L@Mp00,`0 X :0S, 0 4P+ ,,0`00C0S0Ӥ0 wp 02P 0SP 0`0C$ 0p00p PXP  Q-L, 0R (Q 0S 0  0S0aC10C \ 0-L@P0S \ 22 0180`40X1 018  008 4 0 R)ꔎԎ܎x t0 Sh d QX  T P L H -@ < 8 0%x,X T -L  0-L@PM2" 0 180SR!md0S0L01| 0 S S @S  S ^-.+ L0000P L3  040C$ 0'L0EK X!凃 傃0 E/K |0 Q  Q #  0m"4744004 00 0FKA  000&aPP 00b4@$ 0- LP@X0S 0Sx00h0 0- LP@AP  P|0LP 04T;<40 ( 0-LP@0S 0 X0  P  P|0LP 04T;<40 -L`pPM0S 0 0 }0x R t00@0S S S0S S S W00R00SP 0!SMp3h# 0 180SR 0 0S S S0S S S 0S 0   0@@PP(0K0d l0twP 4% d0Sl Px RW 0>S0>S 00S S S0S S S R 0Sl d0s0 rPx0S8SS 3d 00t 4 8p$ " 2P@ 0 0@  040C$ 0 04 0CĠ00 Kl d0x -LP@|M`0Pp 0 00W H VF  dP0T8#1: 0 P0T800SX  hK 0K P30 "0P+00CS0 0 ä0 ] P`Vᜐ 4P K@P0: S @APsP@ 0X0 P0 s@P 0h\   H<  -L M0S 0/|00Qd l0 : -L`PM0S 0 |X@x4p$0 180@B@C1d 0@S( p S S NS(  SO I0R0c0d0dd000Cl0GR0d00d0J0D@R0  d0d l0$ K'0LP $ -0D@R0  d0Cd l0P-(pdplpP"(0  B0d0l 0(00(0 ( 00Cl0d (KP l0( Sl P WLpX -LQpM` 0@00T  R0 P000 S0PPR@VP, @00TݸP@ W @P jPP 0 0000S0@ 0@@ -LpIMM$  4 $  0C$ 0(P 00C$ 0\㑸P  _XJ>K@ K0C T@XH@nP 0QSY4 4SK 0S Q.  6P(x1p!0INK @D1 @D080X$ p 8$u ?0S00C$ 0iP  0SiP  PM    DK00C$ 0[%p0K0 㰹?O$[P`%; S@1 @#0T:@ S0<0E0X @0 X 0D0 $2DPK  000K<@ 0T8$#300RD0  %PL0,0  'iPX00L, X0  4SL"0PrP $R  2 $ P~  Py4  Q 03  60S 00C$  0pP  jX00C$ 0Q0 0H $P :P 00$0 (K(@  0P@ 0P 0S0C0`X0+X00X0 0 b -LpPM@T   K( 00 (K$0  , 0 Kp 0 M0S00``X0X00X0     0 @S@\ 0 @PT ` p-LPM@T  0K( $K$0 0 0 0, , K p0 p0S00``X0X00X0   0@S@~\0 @PT `p -L`Pp M@T  k c 0K(0 0$0 (K0 K00` ,p 0s\  0X 00OX00X0  ?  0, -L@M R 1Q \ 4 x0| 00a0T Q 0&P -LPpM@T `V `4 x0| 00a000(K8K,0 0K0 0 p P l 0`0 v(4 80 0 |0P(L 0h -PLp`0S 0@0T U 0S _eP0@0TW  mOe -`pLP@0M-` `,p0`(p$p`8d0S$ 0X00X0 -L@M0S 000S 000 $ 0, 00( - X0 ,0LPS0,0, p-L` 0PM@ \ e!P $ 0P, (0 0 00 0( K$0 ( K0 0s, q (00$0 (0p p-LP`$M@X$ p,0S0 X0 P,V$0K K P $Q p0 0 00  P 0 0S  P 0`$K ⳤ ⮤ (0 ,0 0(0 4 00 ,K4 Kp$F/(00$0(0p鼗 p-LP`M@X0p,0S LP(, 0S 0 P  00 i(0 0 00 0( K$0 ( K0 p$$ p(00$0(0p^ -LP4M`X "2 " (@T "!0X0( 0D @0 DK(00CLpK(0  0  PL@00CSU0d0X   X00X0 PKPPd00d03 PK0 0CP)P\00\0# PKޣ0 0CPiPX0P S`00X `0 <Kɣ4X X K00,[T P X00X0 -L`4M@X0 !(P ! 0X0( 0< ,L L K0($[H P ꐴX00X0 -LP4M`X,2 "( $0R  "s%.}0X0( 0D @0 DK(00LpK(0  0  PL@00CSX,X (00(0  X00X0 PK٢0 0CPP\00\00 PKɢPmPd00d0# PK⼢0 0CPGPX0P S`00X `0 <K⧢4X X K00,[T lP X00X0D 0-LP@M+P 0@@00S 00h -L`@|p_Mh8SX8h8  K0P8S8880@唑 @00,pP| 0倐@DAP <P 5P 0PQ -PvT8@0P    H?0@8SgHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH,8 1Sp60 1, (T8@0T8$"P  tXrs ! 01 rXk tX50t1  g501 %6p50Qq %  T8! ! _/KP|! R@ 00S0  |106040Q4 0| P'Y0VKX1  U/KU008001S+001S40000|PP Q QOK0X${mhA 峵0`1 Z?K1 aK^?K |1 xQ pQ !R  0|Pg * 0|Pa E 0|P[  0|IPU |!474| 2"0 18 `14 X!0 18 Q00S8  ǿP|4 prX0S|P|f |x4p$0 180 000P0 400!4R |P0S |1 0S ;P@'5 }|1 0=G|!rX:4:$p(p4| 0S($Q<P d6P_ |14 0 0C$ 0 |0PQ|00S ||4  jP7 C|4 b/K!, |DK0P1<0S S40 SS |d|1$   #S$ |14_?K &YJP|1S@ ` X P @X= TA ԑsDDl 0-LPMP  @P P@P PT8`W!l@T0 LP 0@ 4 8H R000 l@T0 | p-L`PM<@0+S0S+P I"P  -00c00NF-S0SP t/ pv TScS tS wS0SPP 岟Pp 0-@LPH T <4GU )F G 0h |08 -L@M8 R Q000*8 R`Q -@'@L`PP pW R0 0V?Q0 0 T0 0V?B0 Q 0S P T0 0V?(0   -`QLP'PM`p8P@ 0S UP tT 800S80 8008 00S0 @@V00V 00 P08 R0S: R p-LP`MQ/@-08@T& 0S:0C0000/ @TPKPp0Sp 08@T 0S00%@Tp -P- LP MQ Q'0AS! pL4 <4440180ST80T8  <4440180S 4 ɯT#00S0;40  U  R t0ZT8<T8 4  4 U@ @T,  T8  40S,  , K Px04 Rtx 40rP tT8x K 0C0C(4 AK0B.K$4 A0 B 4 A B0 P,$R0fP@ l 0S00\0 [0h ,0R0h`DL|< Pd -Lh0S  -LQ4 < D L T \ 0,($ h$0 p-L@P`0M000/ 000* 000% 0|S"0K$0 0 0 U P h\ $K, K 0 P ( R V0B0,00C,p@V Ʈp -0Lp`M0 R 1000  R0S X  R t0UT8<T8 pX nPP@T T8  PZ,P , K 0dPPx0Ztx  0XP tT8x tP 0 00 2PX$0sX$ X40 2 $u0@P\htx\h|t(  -L@4M@ D 0S0T0 H0 q PPH `  P @0p0S`P P ?S=SUD R0P)=S`0S0X,0 L0 0PL 0nS0oSp0,0 L L0SF8L 0cCRᅐP01 @ 0 R00?S@00@0 `L0Sd d  T L  ,20Q00S 8 20Q00S  7KdP R 7 BV H0QH aQ 01!  0 180SR01!  0 180SR Q   00L0\  ,0K P,`K 04P 0P 0P T |L  03w, R  00j,0S 5P0!V0S5 000J 0K4 K 0 P`; 8 KP< KpV l ` | ` @%4%0p80S T  R t0UT8<T8 ἤ<0S T  R t0WT8<T8 ᬤ400S3 S S0 8 KP< K0pL$pL80S T  R t0UT8<T8 ᄤ<0S T  R t0WT8<T8 tL @ 00S 3401!0  0 180SR  00PzL\ 00K  P0`K 0BP 0P 0PL 03 00| ,0S T2P0!V0S H R 0H 00nL  0  ṩ 1L 001!  0 180SR 01!0 181PC L  0  0RP 0T0 3L\  0 P# 0ųP0 HP0 P L 03 0 P  T Q@0@0 0SHQeTHl, -Lp`M0P 0!8@@ JP`  0 S PS`S PI` -01L00180S 0SR0  " d -LP M 8@  ZIYʜ0S   |ğ0lCbQb< @  $ ]0SS W01! 0 180!10 0!<00Q701! 0 180!10 0!<00Q 0!10 0!<00S 01!0 18010 0!<Pd011^Z@ ! 000P0pS?    01!  0 180SRp,01! 0 1OK080"_'p01!  0 180SR 01!0 18 pp0JW( K 1 b"(K1 @a" 0S02S8 S@   @P@0 pW! X`(K122` V `0/ XpWQ t?W"pW(K1@18"pW(+'鴨L4l $ -LM41 0cC RFh! h! ! ! 01!  0 180SR   0 01! 0 1800 ҹ 01!@  0 180SR@0 01! 0 1800  Ჹ鴨0 -LPMD0S 0( 0aCrR񟗶" " H# # 01!  0 180SR  :01! 0 1080 |:ꇐ01!  0 180SR} 8`@T' T T \T0 CR \0R00:0 CR 0R T 0@0:@T0 CR =0R00:01! 0 18``@T' T T \T0 CR \0R00:0 CR 0R T 0@0:@T00CS0 0 ä0 w: 0@  s0S2鴨 -L0P& 4K M4P 8P`0,KP 0,P 8P@pG@0S` 00\ :]PWp0S' ĭ' 0 ;彑庑 -L`-MdpP0120SB1@?X0S 0 @0 @-@ @P 0 @10 0!<00S 10 0!<00 P  pOW Pɱ괨 -LP@O`p0S1P10 0!<00S 10 0!<`Vp @I괨 -LDM \0Y  -L0\( >\ } ( 0-L@PM\!0 \!>f0 0(Px(p$0 18p4 0!<0t4Q p$ 0 180SR: @0J@ J0@,0@00p$0 18p4 0!<0t4Q p$ 0 180SR L0JLJ 00X -L  -LA -L@MV4 040S4&64$ -L@M4 Zr4544 Rr4544 04 -LM\ 0  -Lp K@P`M`P  K\ 0*9 -Lp K@P`M`P  KL\ 0 -Lp K@P`M`P  K \ 0- 20C01800CQ :2C0180CP00 -LQpPM<0 /R0 qW)%2#50005 0@q0W 0S pWW Q00V?0l% <@T",KPD,0S@X 0, P\ ,00 X,0 \  00 0<# 0@S  N0X0,  0, \P\ ,00 X,0 \ @@ 4K00K , qPU@@T T8  04 00S8  8 K P4 00x 0Stx p P} tT8x P   ,\PT 0``V$᢫``VP` @TP`Q0 0V ያ@DTP`Y! 0S ``V|x``V@T PQ0 0Vw @DeTP_pW $ -L@MDqW,0 0, R$0 Y z`V7 P|UU U U U0 0S7 SR7S:  P0 CR 0R00,0 CR 0R U 0P0,`V0 CR 0R00r,0S8 `V4 P|UU U0 0S7 SR7S: n P0 CR 0R00I,0 CR 0R U 0P08,`V00CS0 0 ä0 +,pW_R 0 S0Pl R S-L`p 0 S)0 \ P \2Qꊒ@ T@  bP 0-L0 K@MP0 K0KP 0S00S0 U0)0e S 0  0 S S  0@S 0  0 S S 0S00A00 -L/@M0P 0-LpP`ၑP@  00 -L`P@pᏘ00 凘0S 0"S0s -L`P@pr00 Cj0S e0"S p  P  -Lp`M00 @*Q@Q47 $ 494`1000P10@A0  T 0S @TT Q00V 0 PU  0\ /P0  &P0PU00  4@K0@ N0  P$x -L01001S |d Xd `d hd pd hhBhh#˓ 0-L@0100QUd d d d d 0%j꫓0Q0 0-L@PP0@0, 0CR<D@0 0 010 p-LP@$KM00 `0a0 41 K 0KP $0S Qp0    80 B0r0  0 Q *0S Q B r, 0R0`@0D 040<0p 0-L@PP 0R00:Q0A0H000>@000 -L@KK`pPM40 PD,K 0d 鼗 p-L@M`PUt  <p \ L00 4$ P 0B04 壧ph$ -L⤀K@`p M0P 0P  \PNPpp O p-L@KP` M<40K(K 0 3p p-L@KP` M<40K(K 0 p6 p-L@K 0KMP`7(K 0 p0 -Lp`M@T  PK^ 0Kxቔ,K0   p-LP`M11 0180S 8^K1 0  K0:K@KH00X 0(K0!d p p-L@K P`M< 0* p -L`PM00 , d1R <R <娀K40@ p@@ 0$@0p!壋P0$0 00 4 V0! @P@xp80S L H0D 3먀K<40 @@0 $@ 00CoP 0$0 00 4 "ܳ8A p-LP` @ M^ 0,K ^H Kp鲐 p-LP@M 0`PVp p -LpP M|00S41: Pex`8@T 0SPWp@T> T<T1L! 0 180SR PB0 @@喞P5]34 00CS0 0 ä0 F'_z,K5P,0S,00,0Y 474,K5P  PW *A$ p-L`0KP@ ML  `P0L0P` P0S:R0B0P000L P> 000D Hp p-L@MP0SP KP FP` Qp0 0 00L 0 04C$ 0h L0S0L0 @4844:4p 0-LK0K PMLqP L@T )$\T 0 НP4 <4 0 p-L@` M00SP 00P0UK  0 0S P0 P p p-L@MP{`V  8P 0 P0  X0@0X0 p -LM 0#S+000+S-S (0 # 00 0 0S 0 K0K 4 KP 0Sz0 8PUs*5000 PUh*000Ua* UPP L60`e V000R00S 00xSXS$5p000  :-P1 00$4XQ9 V000R00S 4p00000  8Q 9Q〄!V -R+R P4p 000L  0 400 0 p $o0pW9*0 S S -Q )3 000 8R 9R080CS | 0 L3000 0(3000,PS0pW:Y@ @0eT0 ` T8  020S㜠   K  P0x 20Stx P tT8x  0P0 1S$1(0  1!1c!0VL(0 0P (0KL ,KPL0   P L(0KL ,KPL0 C 00 ,0000  (0 鼗 -LP`$M00< 4> 0Q00 4K, K00KnP 40S  f0010p0 080 14! 0 180SR 8 Pp80P014 SL  1!1c!0X#4 <0R00<@ 4 0OqP~0 00 Rp vz,0 p0044< 0.qP]X7 80S4 40K,0K POV@@T T8  80@S8@ 8 K+P@:8x0P0tx P/ tx T88 V V !<$K 0|P0@ $0R:R ,0S 000000`0@0@ <P ꢈ,0S 0D0V < 40R@ 80R4 <0R8 @0R4 40VD  40<S*@0SA<$`K `$P$0S0C@00 4$0 eP$08 R00000@00C@0 -LPLK,M\2T0 18``4D KH0KP8p L0SH0W:"'D0 &Pp @f0$ Z2 40R2 80Rx"000 d2 X20@4H"H2@K``@ @0000 0FR<00B0Q@0D 040<0< -LP M,0S4` 0 80S0C80 V400 F04 0040Sa,K0K 0&PW000 @@Q@ ,P p80Sp@D``F 0 P;W W+ 50Q ,P @T. p,0 S@T#.S0\0| R 0R  R\ 0R@T  R0Q ,P@Tp`0<`<@0D  Q-Lp` `XP P ǂP@  霠|P'W |tX wt|A -LPp M00 h00 @@@Dt& 00404  D`0`@Dm R0 T! |P0T8 t -LP`M00 /00 @@@Dt& 00404  Dp0p@D4 R 0T!  CP0T8 t010CSX ` h p x 2 3 4 5 6 7 8 9 0  -L0 -LLKpH0K P,M4`PL RX$"0 80 00C B4S<@04M B00 e, P D@K00S<00C S' 4 4 X p ` p p p p H Y40S S  80[<140@14;4 S,P U@@T T8  L0SP P KPLx0P0tx P tT8x P0S0C0@00S0C@004 P@ @ k 8< .4L0 S@UP t0XT8<T8 Z< D0 0-LK@0K PM4P 0SP0000 8 00@R@,0S 0 @ R,D :0@Q@0 040<0Q 0 40 B@ < D00 0-L@PM00  0S 0@0@ 4P/,0S 0 @08 R0000000C0P<K0K +P 0S 00 Q, R 0 T0R 000AR@0D 040<00, -L4d  0R 0S< 0S0$$$44:4 p-L@`M00  PPp 0-@L0050 0< C08PP0)00 0-0@L< 8PP000 0-@L0050 0< C08PP0000@-<0D,0Q000000@0U00:4 @ 80R*$0Q0U40000茶 0- LD @00000 HPDHPD逈@@x( -LM0S S 0 b -L 0MPW p-LPP@` M0@41T T8  @P@ 0 KuP@ x0P 0tx iPtpx T8 4 < H00C0080D0 -L;Ky #(HM!`N@&SQom^gDXjmsgxF_TAKey^{0\q[STo^"dM KW/TqUsr73]jB ROo?{o{v-̸b85;waeK}-7JٛRKXN )k43ա=kkNwʤ_S)FcG/8uN߀{:_g36 9 '54rH\f EE93 c`Ym"ViO@4L3|~g&lAڇshN B%hIN<R- X-S@8,XGۋ)nC' 7><=e^m =->,yffQ:hc0Z~sStU߽%7 dt6:gðJ#o6^2{Cj*w55x8-rNFU5`G;wJ;`ޤ>+$ti~VBLduK.#0nDiiIhcwDnH _2`LfQy8mF*R'e|zTi_=*ZY7lx8C7 3:@#GXQV߃j9F 7uG/,i^|\o^'QdHQm o9$vb8~)SZ $28odc`"`>hNzLp.ohzvdD͑6:A%n5[\"n7?KlKZpg(S@-mωi:P:oxdH:>.AO$.EUoEn6tzqjAA{L 1X46 oka,[_Q)SПv?6Z@hmuzk\r'2e#ON x./.є NX1,}U1 L/if_F `;\eWJL|6#H(AO8{)3r_vϰk0h8gGҜee]E` wk]\zU ] p}&=qdd4DK 0P D0S C00 08 000D80< D0 - L4 -L@pPMLPDHFP0!4 Y2[L PP4 0 0 180SRP($ 0 180SRR ` 0P `P424LP 40S4@04D P0L @-40S6 0101@01D01<01@0R1 !01@C\ * 0 000 0Q:0 . 0 0 @1  01< @D p-L@M40S`G <1D0!S10C@ 1 QP  00l@0PU0<  A2 " 0 180SR0!0R 1S 0Pp0!0R 1S10C$!1p -Lpx@`AMx\    0S P 0R*c0V0(0$0 0`  Jj  0bPP; 00S0P0L PS080   00a0(000c0C0a  0   P "20Y00S 0 PdP00  $0 $ 0 0  00$ 0 00$ 0  00 0 00 )  1 40 180   1  !R80 b !  40 180   1 T800 1   ! 01 050     0 00K0 L0P ! U"P00 DK0  ¿P0S 4#20 \4 QL a00 0#X0 0T `K T1\1X1 ")"00C SD 4;4DK!P L ,0S S 0 000 000 000N;0Y00S RD1S54! 0{&!RD  TL! 0 180SR L!0 1800 0S ! 0 180SR !0 1800 0S\^  $0R8^ Kg001  10 S1 P/+0 0 1iAH1P 0DR/0P D  D0 D!1iP 0 S ! I 011SS000 00 Q 00CS0( 0C  0( !R0 S01  Q l> 000D01 Pu0LSM  X l 8 4    8  (P O4 -0幽$ Q0==1ST8 K8 K6P, R=0Q  0 K0 R0 B0C0 00 40'P0(`0V00S,  # V 0 S S ,0`V0,0 0 S S V,X* 0 S S&,0X0,0 0 S S  1 ! 0 180SR X 0 S SX 0 S S ` 01`P@ x (`00x0S0  x@0 # !R K0@PWQ 0t ST8<T8 v0 @P01 0P02 R0S0S' 00 0 0 0S P_ 0K 0 DgK  00  ( ! (0S 0S 0S gP4 0 00 00 0 0 0  P&P 0  P5$@  (0$ 0 (L$ Q0800[ 0Q:080Q T8 K8 KP R0 0 Kz R0 B0C0 x0  (Q R0f0( 0b0 "=@ x P  0S P  0@0S0C0 U&P  Rp0 k Rg0 ! b0_ Q 1S 9:S BPR $000QMP  0 KPe  Pf0 0 0  R4 $000Q/  00  C00 $  a0(0 R $00Q w $R0080R  x0P@PR0[B  00(0 0R(00A2050Sx 0P@ P $R0S Rࠁ00R00S S S ( 0A S( 00P S S Qw 0 Q0[(  ( @ 0 0 000S S S} Rz 0[(  ( 0A 00 00S S SJ  R 00S30000_Q00 RS0[(  ( L 0` 0 20 P00@_R`T60Q S S2 \/0Sx 0P@j P $R0 0S Rࠁ00[(0 n0(0 00C 0 0S0[00K0   P 60 ! 01 !^0 0 0000 ^ 0@ 0 000  \ \  ^0 @ 000/_R- !R T8 K8 KP R 0 0bCH. 0 S S0 0 KvQ 0 00_R01  ! 0>PP0( 0C 0( Q Q  P !R K["P0 S: K0KmP0S 0  S S  ! *0 S: 0P0 Px 0 00 00 0 0 0 1S S0S01 P001S $P<Q 01SP0 ! \1ST8 4Q XP !R01S 0 L0P 1SP 0[ 0K P 0m S4 34L40 H0D 43x4 -L@pM$0Q ` A0QP)  U R R% 000_R AQPE  U000_R AQPE  U000_R R RW 0Q $0Q |kP000S`0  ``"PP 0( Kp0b 0pP pP 00h0 \(0%0 (0%* R ( \c (00(0 0 0c c  -L@M0C 0 S S 0\ $0\@L0\ $0\"kP00000 -L`0 MQ0 , 0 $0S R Q000 34  01800pCw4P @  0 S S S _lX `@pGwP 0 S S X X0#03T00Sp@ Dl `0 S@p4 d a0R @c00d bb0 pG d0dw0 P pG 0w0Hx H 0x0,00 p-LR` M 0 0P0  Q p K0K 屺P 0 S 0 S S 00CS 0  @Rp 0S Pp Rmb000 fb@p p-LP`M@T0  p(04S 0S  00 0 00 000 R000 0Z !Pp -L`P@ M30 0 180 18U*00 S rk ` S 00]1 @ܶ@0PU:00S [k`ppDTkp`00S040  0$ 0Q040 $Q00S S S ( 0A S( 00P S S 0PU@*00 S #k ` S 00]1 @@0PU:T@#! *P  k `0SP@e40S00 0X)0K ) K0X 0T)0K ) K0@T -LPM0! S !  1`  0 pC`0 S S` 0W $0W`FpG 0Spa P 0`COK*0  0 0僨lPp0 mP X   X -!R0d00suY@J00 ,PB1S00KQ5P0: S` !R0d1@@P0H0X@ژ!0T@!P*0 0Q P*1 00Q HX@ʘ00YT Y00@T00 S Y 0( 0i 0( T3 (0S 00@T( 0 B00( & RT" 0Spa P3 0 0 \`0  `@Dt 0@Dt0X100K4P*0: S&(0S 0Spa P 0R`S`0000C(0000 /0! 0 -Lp/$M000  4 傡P`@  0@00PJ0c0U@0 @ 0SPE@:00 ,P @ U0Z P0@<0 0@ 0S` 0S 00]10S< R 1< PEU@<\i$<">`02<  4H0 H 8<0S*Z P0@0@ , Km`$ ᑆ4T8PE@U,0S W  R t0VT8<T8 [n4 T8[@<.iZP  'i P iPP0SD0 B* XD@2*01@ , K-`( Q,0S8 W  R t0VT8<T8 "n4T8&@ T *<08 a024 T8 X:C4T8D  RD :\74T8R4 T80T8H0S424ܵ< l $ -LPpM 0 Q5B $K 0KYQ00] $ $QA 0S \P  $0R@d  0 _0( 0 0( 0  Q` 0@Dt 0  @D 0t0Q0 0Vڳ 00@Dt 0  0@Dt0 0$    0-LP0@᝸PT@D4T@0  40L P00 -@ `L0p 0 C0S 0Q@` $0QA VP t Ps0SU 0p 0p 0 f0f 0PA( R0^ \ 0(  t^ -LP`M(0 S 0C(00 00S  Q$ 0@(K$0K w $0@Q0 0]' ( (0Sp (0S (  B( $0K$  R  ,KVR00] , ,K Q aH J: 0S SPz ,0K@C$0(  0 ^0( 0 0( $0  Q @D0t  @D 0t0Q 0 0( 0Vβ(0 $0@D t  0@Dt00(0 R( p (0SW 00gS0 ( $0  ](P 00   0S P 0 0P0 0P 0  (  ] 00   -L@Pp`M4P< Q4 D000 0R\SQ 0R\S 30 180S# P  R 000S\S 40D 0 0PR Q 0P\S 4 D0000001!$4 B3!4XPS0 40 K@D0 KH0 /RD (KLPLPP000D P0L 0000QPP43!4$ B00!0X  0> P 0 -L"r0P M@$0 $ K 0MP'$0S  ~P`@xT 0$ K$0 0 `⋵0S $0S _P @T434 -LP@ M0 L0P 8PXDK 0#PP Ro ᗭP@DX0D&s@z 8pK00S$0Sn S(0[ S ST@D, R 0BrPm$0SY tVs@S $0S1( [000_R 8pKPP$Q1; Q( [ R R X000_R 000_RT, R 0 $1R >R P !Q(0[ S SP$0S @Dt,Q 0 4 80S8 40S44 80Q<0@  0 $0S0B@0QD 040<0,<  -LP`8pKM008  40@@80 4 JP$0S(0[ S S gP$0S(0[ S SᵬPX0D"s@l 8pKO0St$ R` R(0[ S ST@DR=ꕬPc$0SO tLs@I $0S1( [000_R 8pKPF$QT11 Q( [ R R X000_R 000_RTQoP !Q(0[ S SHP$0S @Dt,Q 0 4 80S8 40S480<0QD40@0 040<0  -LP`8pKM008  40@@80 4 傫P$0S(0[ S S P$0S(0[ S SHP}X0D"s@l 8pK0Sn$ R` R(0[ S ST@DR=(P]$0SO tLs@I $0S1( [000_R 8pK˫P@$Q@11 Q( [ R R X000_R 000_RTQ2P Q(0[ S S۫P$0S @Dt840Q8 40S4S4 <D0@ < ,Q 0800C80 p-L K@0K ` M4kP 0SQ ĸp0 @0 00C@0 A@0S80:@ S0CH04 0R00:Q0A0H00 0-LP@M00 400  00 嚰PK°Pz008  0H D0 Q xp$ 0 180QQp$0 18000`PW -R +R 9.R ^R 4 H D00 < D0#  P 4D0200 < D0  P" D0P D {0Q0SR7QūP P  (0 )0P0 -<D400CQ<0D0< 1 1@0C1 0-L@ PM0X0 PP 0S ՝P4<4 0 -LtpKL lM@fjD0 0D0 PP 0 0` 1S 1!1c!0  P1!,B41!00P00 1@0C$T!1 1S 1!1c!00|0 oP | |0PU5(0vL j0xK|PK PVP       `(0 p3h# 0 180SR Q0 0Vf  ဝ0  x0S 000000 L00 P00 00L P4 8D < H@ 0 P 0T8#1 0}P0T800  <0 00C<0,00,0(0P$ * +㋣PPKCP R'P00PP 0 0`@10C$!100 |0SL i :0D0  ;00?0000> S$ S! S S @S0H0 S !D@ H 1@0C$!1DH .P fDL0 H P  0Q  0Q0P ' K0vP [PL!0T8#1  0ɪP0T8 0T( T(@P  ݵ4  :44 @ 0`010C$!1$ P$  0;4 0T84e @R 露L| -SLDK00`$M H 0p[P@ Pz  s40 S 00[00Z8P["U)Z S  07P@40 S 00[  008 [< 000#P@40 S 00[08P[Ɵ000#100U00S 0  P!00 ;0000 0P@40 Sv 00[8P["U7004@ %Z  DPK  0P@40 S_ 00[0 008 [<  000P@40 SK 00[8P[~U U0 0Vp P0DS 00   00000;000S P ~U 4$ 0 180SRP0S(;.U U0 0V54  R  ~H0Sc 0!,0R00:003(0H06@#凴r00 ;H00 00  H 00L Hg00  6 Z 0 D K  0*P@40 S 00[00008 [< 000]S[S ZS-D K0P@40 S 00[008P[0S Z ~Q 4$ 0 180SR2"2 0zS2D K0P@40 Sj 00[0080[0000  P00:00D K0P@40 SI 00[ 0080[0Z 0S U0 0V?g0 ӳ D K0P@40 S 00[0080[00 PX :X < 嫳0dL,X -LPpt@KdM0 &`  L fD0:0D0 L fxK 0P6D 0 p p  0;+;D p 00 t0[R)00 000@|K8@ L0400pL A<P <0S !0R0cR00S  |0S0C@0_(0夑 SH0 tK1(000n>00 ` `L@ D0LP.0D0 0 , @ 8 < 4 P<ძP <0S !0R0cR00S@0 D00 ;;Z (00 008 @0SL0,0 < 40R80K4 <@0K@0K4 <80K0 KD0(00 tKL !f0 -LP@`PD \400 "4"0 1800140`1X!0 1800x80p$0 14800QD0<0@  AS< 0D  卲400C@0pHp@UP |L00<0$010C,1 0$0p10C$!110C$!1 t -L`pP@0T 0P _ 01 R0p0 0Q00 000S0@@@@T0Q   Q000 000S0``W` 0Gh p-L K0K ` MLɨPPP U*H1000 PU*000U: pPPPD @ 000_R   R *0000_Q0^ @41e\ 0M/ 0P 0 0XP 0 0 p -L@ M0C0CS1x- - - - - - - - - - - - - - - - - - - - - - - $0$00Kd0_00Kc0_00Ky00 K0 囥P  0  p-LP`M(K([10@L^4 K 04 K 0P h0( [000H 0IpP 0( [000#1@p  -LP@p`M 0 R 00C` S!\/ / / t/ / / / / / / / / 0S`0dDP X -LPpM 0 0\1S 0! b!12@448P *R0AR00S0@P@@T0 0K K0 p0a1248 0 0KKl28 "8 0 180SR00C0 0   0"0 180 0  " 2 " 0 180SR XI 0S0S @K0)1 0XX\O^ L0R 0! b!1248 800i0QO R +X 0S~  0S$ Q $ 0@T0 0Vo崣`T0 0] 0Xl^   P 2  0 00 " 0 180SR+  R'01W& GP"  0R 0R0 0   00 2 " 0 180SR P82̀  " 0 180SR: Z.*0 Q 0  R0 18@@0 18W`` 0 R0 0]a`X*0Z:X0`8`c<00A Z=*0 R 0 0S0 18@@0 18sW``  R0 0]aܢ` X:Pi 8 0Z:X `h00C` 0 ` R L0RP R: 0S0j 0"0 %*0S +0ZK  *0 R 0 0S0 1@8@ 0 18W``n W``a0 R 0 0]1`nn`a X:\0i`c  `` ``c` X000 ^9 ^ 6 =R00S- 0! b!1248Q 0 0f0H002" 0 180SR >0# 0R00S000PQC\ `Fv> 0)KKS`F l :00 0X 00v ')K0S:@K d0X@  R 0 00V`Fv 0 0`Fv 0Z00 *: X>*^ 000 00 R0 0] 00C0Q 0 5b)K0S :0@K0 d0X@ 0`Fv# 00`Fv  X151l5 KR00 a0X 0 -LPM4pP01Q4 K0Kp0!aV;2 " 0 180SR 0S0S$X00Q00S )P 0a1248 ,@KP 0j X01`V04  -LP`M4Rp@3 R RF }W/ 0R`1wSud!]9[.p$ Ka@04S1A"` $ XZ/(KplG`!RM \1S0B`1 S 4@0S1A" l[4\aV4`1S1 0Kt10  c2b3c!x,00a3 Sd1S]?da4@0S1A"h!d1T0d1 X4@0h!S1A"G -L@M@04 SB"0 0 -L@p M4` !X00Q 8rrr$K( Kp4@0S1A" lWP _800CPP PXX _8 0AR0eC X$( 鼗 -L`@MĐ0p80 T8 T80T80T8d4P*   0PX \ X \P4740 0J,K0 KpX 000S S40`FS4P 4 K 80X408 P4 B 00 S80P!0!0p!0k80P VV 0 S S`V O 0 S S VI 80X0 SP 0`Q 0 S S AQ0 S SQ 0`P 0Q S SPA0Q S S 0b`V0bS00S.SA0b&V 0 0T8#1  0㓠P0T8 ,0 $u$ -LPSM0  圀ڸ  rP P0 0` 0 X!80Sb R4UQ, \1S@0SC2A"0  lY\1T!A0 \1T!\!@0R  T1 B0C@\!T1\1S 4@0S1A" 00T8\!T#1 0\!T} 0P 0T8r@0S1A"0P 0\ @z㨐K 2 0p W p`V0 0]Aጞ@0)KS :0K c00K⨐K0XV0 0V} @Dt 0@Dt0Jz KY00 a0XP 0\ l0 Sb @ 0X1K 00 00 P! RV/K0p -pL`@MpP1X!0RC$!1 0P!0XqP1$ 0P":\1S7“44640T8#1 0JP0T84    0S10C$1!0 0R@04 14 04\4\!70R40T1\1X140R b040  #0( 0 <KT1\1X1jT -LQP(MpDKH K`pT80T8d4 4L4 Gl0S" 4[Pl@T  R000 2W0Wl@T10C$!1\1S S Z  $10C$!10  4 \, 0Q80 0a00#40 0@STA\AXA@KDH  -L@pM4PP` \Q#*@0S0a a0C" t0 0R 4@0S1A" WT!@0R9 i -L@ M@40P1C"`p40SD K XD K D K213 :XD K RYq040KT80T8$!D X\1P0\1TQlZP 0@K 0S80S S dX 9X40[qST80T84 [0Z0:R00S p-L@ M8P`UP#\ X \p  -Lp`MPLP@" UP   Gl Rl0 P0l@ 0S 0S00S0@@ V 0iU|0 0-L@P 0\00 A 0P0 0 0S 00 -LP4@` @ T T44@04@T220180Sp1P@ T 4 `0!14 03!140C$!1@TZ4 01SP@pT 4 @TX404 -L PDM4 d \ ` 圀 !4 LL d %PG4@04D0@ S L 0R!* 0@ R@ PGPETr <0So 0! ! P!<0@T < b @0R^0RZ 0@ R@ P!PTL <0SI 0 C Q 0P<0@T < 2 @0R.@04S1A" l< D0R0.B1248 l< 1D B0CR1< L L 0R!:0R4 |v<0S0<0S@ P:2P0@Dtr  P@Dtj4 ^X<0S0 <Q@0 P:1P/1廟P @DtL U P@DntDDK؟Pf0!L<0@ @KD < 8 <0S@ P:PD 1 0@0 Q80 130< @KL <0S@ P:PL  P)4@042 " 0 180SR_ 1L0Q 10QUP u`L 0R"0V*< R0f S S 1` 4@04 10V* P010V:L 0R"0V< R0c S S 1` 4@04 10V P010V4@ 2 " 0 180SRE\0 1L1QP 1R PKH KL0KP P0SP!PHD*L0R0 `H0 `*10S:r` p H0S Z  H0 t Z00]1pǙp`Fv@ TpG 0 0]1S ᶙP T 0 0]10cp ᨙ`p1S0g 1%A*F`b0`F0vH0 q% H0 ZH0 9 Z 0 0]1p ሙp2"8 0 180SR 0AWW*`Fvq2"8 0 180SR 0AWW*TKX Kp0AL 0S 0S2 " 0 180SRd L P0`" 0 180SR`F\ :3 0180P3-:3 0180cP*#\"8 0 180SR00C0S:\! 800S*33 018080S:400!AT@T d $Aa4@01T0T0 01V L0RRT K=OPqT0s01@TC L0R >0!AT00@01T0!A0T0 T01T K=&PHT0s 1SA01@T4@ @ S <`V  l@0`V0`0 PP0L 1!4  04\2" 0 180SR 1` 20  P d0S\  \ \0@ 40S 14 \  !Td0ST4>410C$!1 -L@$M 0S @04S1A" 0 0Rp0Sm P0S 0S0PE8 Uᢀ`A0/S P: S00]1ppW0q"2  pW`0S 00]1pcٗp`W 00PEUV `Fv q"`FXv"XQ Q0 0Vo`Q0 0]  XQl@38 B8# 0 180SR- @Ko@  Z<0S0 18``0 18I` R0 0] : 4 pW:,0 `cF00CP!80SP 8U: ZPaI8Pp`Hx00C -LRQp`PM@ RQPp`1V0p`W/10W-*V(o m 4n n <Aq! 0A0Cq0L0S0C"*<Aq! 0A0q0L0S:0L01 0C$!101!L0 SB41!10C$!1$"> \1S10C$!1 K$ K0pV V V PoP 1 0C$!1P Q $ 0 -L`pM1 dU00C0U!0QB01U P*P 0P01U -LpM0!0S` 0 S  <0P4% 0#4%#)0f1a2!48"$(P0X! P 0! f!1248  h @A! =0!T000TPU@0P 0P@APU -LpMa0S 0 S2 " 0 180SR@ !V@ 0 S@T0 S   <0X4% 0##4%) X   0P`eV)M*! f!1248 P hX!U"a1248 0 P@0! f!1248  h ! \=Jz@Pn 01Vj0P 0JPz@P[ 01TVa1248 0jP 0! f!1248  h , ! J=z@P 0P 0J@nPPz0,!0AB01T @*P 0TP01T -LP Kp`M@ČL@P)T{ 0{ 0{ 0{ { { { 0{  0  0P NTT 0S P  -L@K` @P @ S0`0 XV::0 P`Fv XPK  !0S`FX @0R P  v0XK P  0|X \K=P 0`0 V4 < R0 0 pW01@ 0S וP 0  0_Pw`0S\00\0 `V<0 <  @0R`0S\0 0 0V pV( 0@ KPU01@0S ᚕP cPGX X 01Up0YQ 1UPE`V`0S&0HS7   \ \ \ ` W 08`0T E2 " 0 180SR000C "V0QV 01U GP `VPL R0P 0  -L @M0P40S ! B  I;0!BP 0h p-L@` M40SPlK K`Fpv t@04 SB" `F vp -L@`p  C!1248 U!01U@w XPs"k01PP!$KxPc A$0ST04ST1TU c!1248 / ADI>  C!1248 / 1 A9>  C!1248 U!%p0@4 P%$K2P0$S0!T04ST0! b!1248 U0ADP vtI R0tP 0 | -LpP`M " 0 180SR QfaQ0C 0@ATPC":U  @DTP:U @0@cTP *U  @TP*U -LP`M40SD#0  040pXWp@(<P  0\ 00@ D @0L8RX8,KP 0, 1 c!1248  R*W@TH 40 0g40H 4pP 4H0 R0H0```0@  a !P7 04p(4  g0H0`4 `404S C Q@  A Y@  T<00a<0@ <0SD0< SD x4p$0 180@0S<0D0<DS C x4D < p$0 1800 AS<0D0Q00D0<040S<0!04100CP1<0!0@1 C0S000!@00S000$4 04 04 0-L@ \ 0 $ LPB40 00\ 0 4 40 @0P40 \404 H H @4 P@^@T+ @0D R400C<0D0U400C @0 <0cςP0L<0!0! B!  U G4440 -LSpP@M` $ $K}P $0S0  T00 ԘW @0R00$0 0R0 0$P $ @000S0  $000Q   Q000 000S0PPP$ 0-LK@MP@P0S s00Q   Q000 000S0@@@0D4: 4!000` -L@`pPPn \ 0 $ LPB40 0@11P4D @4:R8H40L8H4<0D0@0 x4p$0 180@0S<0D0@0!4 P P :K `^D8<0HTd@@  0-LPX0@T  EP400S0@T00S0o 0-LP80@T  EP0 @T0o p-L:`MPP`  00T0@T  xEPphM@T pho -PLp`@0 000 0 @ -PLM  0Sh nS0oSP0  80 (K 50S  o -LpM`V #FP F@@P`0 ``  -LMP`p, Up`0S  -Sh01=PAPVP@00 AP,,K4P@P0G`p  0-LPFM⤽p@   D0SJ/K0{D0s ' 떽E0P K a0C"S \&QRL  @01S040!,0 zd@edAT(Hpd -L1D 0| 00t|0t0x --L | P-LPp`᠀堠0S00S t0@Tth0@tU 0S  0S C 0 `o|tt --L  --L  -L@MF< h, --L 0 0-L/@hMqPUtK Pl0: S r\0dP 004 -L/@ MqP0d  < -L`P|KMqPP@Ƒ K0S10: S0| R000OK@P41: S T SUP@V P U@P xHXh -LN>P ؈ -L>P  -LP  -LtM< P0 p40 8 . P B0P`< uP\ 0*X0SU(  04 P8  20#<<  X0SU 88  0S P@0*@<X* YD3<30Y Tp4f2P0# <<  XpĂPU 0S PUU@o,,4`` @  p@,0^ ^  00@`; R00V0 !0080080 000@@===0 0P B !00C0WP( 4P# 20#<<  R810RpWp 0S 0S4P 20#<< ,Kpz8P' P@T 0S  0@T 0PP|@Tdd夤8- <oo |0 D T p ,$ -LP C0CP:0 000@P*0eP`*B`p@T  AP00S @Tj@{0 000 0 00$ 000@@o 0-LP0PU0 @H @T ,B@T PU0 o @ -LPp @T` 8.Plm@T@+( % 00000@@  p-LP`M @ :0P 00Sp 000p -L`M010S 00S K'*-P DC 00 00K9@TPxD Z*B PP5,:%BPX4$ R 100 0S  00SX ڨpK B-P NK@D@D 0K@ @0I KOK009 )pT' )   !!,!L!!!!"0lP 0 0P -L@4MPp  1P 0P pPK P` 0 $ j 0 P@  @0@T! T0P 00OP@ݢ HP@ +P`h ( 0 U`P @<  "0"@"d"" -LMTTP 0S @ 0?0 ((@ 0SK"|" -LpLMS 0Sl p 8 `@0T 0 ?,PX X @ P 00 0PU(@X 00 X 0 0 0S? 0P0 0Pp(` P( SW 0S hKPb (pK 0S)@Q% ( K`hK&P 0@0G`pP0:S@0G`@Pp@F 0:S0:S0:S < Q( 0S. 0Sp` @ PU P 0:S1 PPPU 00 0 0S  00 0 0Sp(@ 0SW5 h Klpp`8! 0pS @ 0S$PPp(@ 0SW 0p 0!p l  cl PPl0S Sp P p 0S @ 0SX$0 SSpW(@ 0S@""s@#Dd# -L> /d$| -L@pPgM0"̣#q q q p#lP ?P fP3PpP300 zP101  \3oP0 q0#pq $#Op30@cTU  ᆷP  nOKP@K5PT K2!Q00R00S) U'  leKld PPTj nK P@ fK8 8!@0PP91S' K PEP?  :8   /-``! 0_PL#H0<1p` K$1$@=p0 !P0#80jK PHPp  +  - ȶP` t roos$$D< $g$$%%MW$%$oooht@ot%4%L%`%0OPU$+㨶PP`ʤ崶` @ kK!0SP S"40u1  ?0S UAp Ua 'T -LMD@0s000 @0P8o -LM?@?@ -pLSMD HDC<4$0,40NK8TX4`K,1`P``>K`P4 01 l8!  B=98! =41 #HQ0S 0LaS*081 K pC0S D1sX DQU0S P JK#0S`  `af"``a b0S?0S<Ke2/ %P@^20 &#P`UPdUdPX"0aL2`A 0@S0#R`A +@C =@`Tڕd3Ÿ`Qei! 0P`Q nK0P@$5UE%1TY00S!`JK Y0B aT! @w`10`1 1,1b01P a@!  B@! =9 =< <1 @X P@<T  &0 C%0NK`PKS` 0SNK `KP` NK1 f&^K$Y@.AoX H.o< %o|#%%t#%oo%o?~%%2%$onKPTP,5@%0 \:0YPP1/";.K0@#%D  %)K.K 50Q@!QP#o`1qp%1'/O$;h1 >Kd JOK`Q`p&ŠeKH! 0@GU``a@`T`a 0S|a0S0SKa/O NPHT 0LS *`1J/Kc!`A@`A [81S`aJ_Kf$"``a O4P1P@nK1 %0 %K }$"2P@ `!JKb"s`10`1 +1`QPe JoK" 0cP`Q `!JK"[`10`1 1<1<@ 1`QJKeH#0EP`Q DaV`JKl x#:`` 30 JK`!@) -0L @K KM  0  -RL00M< K$K$ 0  0 0 0 P< 0@- LS< T D D D D D D D D D < < D D D D D D D D D D D D D T T T T  ~h% - L@PpMM9 M$ $ $ $ P7PL ( ( 8 8+<  $ 04 7pA':p?@70@cTQ4W 0-S+S. 7`0 @`K 4S \@ X@ T@ XW@704 8040P 6W00KKAA @1p =K0C0C1S5S63\ 0#Ɵ&h6W ENK@D@D&@6di/%PƟTi/03P 4u 8&000,Ɵ,&5W ENK@D@D&5--0PP`R U$0R00 0%i/P@x>00p0UP P4 W  KKL0 L1 P400 4  4 04 \ D840P H0 i$ 0@WP*-Q+Q404 +Q40# H0ST7 400# D0S0- \}ßPK 4#p<&PlZ 렣K^KPE2 0 PE PD$R P+)p' 4&P!$H0R MK@D@D 3 0P)P4 &P 4S3 0 0 3 3 H0KP P4%P\ \ŸPK 4p"PK L 4$R =K0CMK0C@D4  PK0P>\ $RP6W t L 4fP@K=K0C$ ^0S$R lZ0j7P4S \ O+p p x @ٱ p@0 40jTs&D@ g<$&00&<&PL&@\&l&  @4t&&&&'0'" -L` MPᐔp0S  - 000@T:0 O00pp%Pt \9 KPp"0SLj:,0 O00$00 .<'H' p-LA^KPE`MMT T04Pp D:0@$ P<:@lp] -L@M0Shn T' -LP@ `MPL Ppϰp00T0S :@0| |P9@h/`(ǰ@T D90@ P9@ i ]  p-L@A^KPEMM9$ `09`p`' -L h <  -L7 5h|'' -LM4@0,y0 u0qP @0 -LK`PPKQMMK(H(H;K(0C( CK$s (KK3R3$(K3 3 +KH0( B, B0K(A0A0H0K K(@4@0G0KK(L8L0F0K0E0KD000D0K0C0K0B0K0A0K@000@0K0?0K0>0K0=0K,000,0K0+0K0*0K0)0KP @000S 000SHK @#DK @# @K#< @000S8 000S4 000S0 000S,K #0QmK(`F SP@ +K( B< BP000000000QK (J@#J0hpK0( K10 0Q]K(PEP7P @#PE:K@@ p 0p 00( KS20 000 Q=K(0C0C     00 W#@K@ 0p 30(K 0HK D#K@ 0pT -LAK N1\`AMpP$ $K '3\% |7@AK@ @7@ D 0 0R, ( %4[&['[([0,4 +K*K)KBK A "0 4 AK AA p@m T -LBnK`F1\CMM0 8d p, P`F($K (3\& 07@BK@ @x7@4D L2 H2R@ < 94[:[;[<[0@4 ?K>K=KCKAA "044 CKA 0 P p4 0D@0S@0S @?7 @:7 p@57X!@0SD1@0S0@0S @QT   70 0R/ 0$ D4 H$ L P A[X B[X4 D[\ Jt[C[K[L[M[E[F[GD[HT[Id[0B\4B0BB` @P`pN$[O[P4[% '0&00T$ A  T@ 0-L@PL0M0 60 K 0 $ K$0 00s00 -L "'| -L`@Mj@00Sڍ(0$00ooooo -LpMP@Z T <S6000@T 0S#S ;S U`p000000tuP; B!P@ <S6000@0,S00!@ <S5000@P@ <Sڀ5000@0S`I 00TU R 0R R0S 50X .0 Sk T 4 L T @ <Sڌ4000@0000@ <S@4000@p0S9 D0Z00  0`@ <S3000@0;S S  @ <Sl3000@0\S `@ <S 3000@0S S@ <S2000@0S i2PU0 0"߬p 60 0@ <S2000@0Su ,@ <S1000@0S 0 * @ <St1000@ 0SB y0\SSh9 P@@. @DP@ <Sڰ0000@0;SX@#P@ <SX0000@0;Sp@KS= t9P($(4(XH(`(((((,)@)o  L)\)Md)p))) 0-L@M PU 0 \U$ U R= 0[S K<P@0,\S0[S 0  0\S 0S 0\S0nS 0000 \Q0\S00 0S0000 0  0  R0*(*9- 000^S0 0]S0 0 S- ]S* 0[S.\ =\:\000]P0 P P0]S0 P\S0nS 00 0 S ]S0]S   p-L^KPEPE@MMS`V 8[S0 V D0 P , 0 0S5pplo -L@  MY4 0h  @0 0bp0\t104p0pd1,0 0PS0P 5 4 0\S R$ 4 R040 @Q 4 @D! P \000 S0`B 0V0S` 0\S&S\00 S S 000S0 0b, p0g Sʂ , p@@@PP(0oX*d**X* p- L0P@M M  00 8S 8 <S1000    gR 9R1RRp Rp b;Rp _pR wR ZTU0@0V00STTJKA A 㚴 8@0C 8 C0S 8 8 <S0000   (NK0@D@DS  S  0  0S0P0 |0`Vll \p 3 0D p 0 80 8 v* +o   + -LPM M0\SS ~KpGPP jK `FP@`FPP <Sڨ0000P92@62T p i000S$8[S 0  0SH++++ -LpM`MG 8[ S 0\S000S0P\S0ap000g Sʆ`<PNK @D@D P0 0-L@PM09S0S$S /S \S@P@TF  0 00 00 K␳ 4 0,$, 0-L@P0S S0 \0 00 0R R0S00 $@e@ 0h,@, P0-L@P0 0a0CS1 4 | | | | | | | | | | | | | | | | 4 | | | | | | p d 000 0S0 C0S80  +@T0 oT, -LP`  R 2` R| 01@Tp 0S0 PD  @TZ0@00`P 0`l, p-LP` MQ 2`QP0 AT 0S0 P0 0p @Tp` p-L`ML0AT 0S4P0 ^ "+U@`Vp`, p-LP@`M0O/PD X ` | 01,1 $1 1` 10 '/ 0 / p?@0 00 AQ @P 0S`0TTP N1u< sosoop,|,Do$- -L`pMp0S; :S[ TRP D2 Q  Q *$A 2P@1= 0 0 1 0A0!P K00 1@1 00Q P@ X!0Q0#S0nSP1!000@00$P0S 0 0#S0nS0  @WpGQ Q  0 \ z 000000 0 0 0  0b cogb ob -bo -LMT20S2HrP@2 <  0SR$2$b0 20 0P@g0 0A 00C0S0Ӥ0p T000q0S00#LA(K#0 0@P 800S 30Z!0 (  0 000 " 0P00 0S0000 01P@0. 0lD@ 00C0S0Ӥ0ApP$` "ccogo6 o 0-PL @0 0(@0 -L@M 00@ -LM(P@/ 6<  -PL@Mh,)P@/ <  -`LPLp0S(8 07@ 0.c -`-@LT/0DSH<D0 @00  @T|--oo -L6M006Z P 0:0CCS񟗂 P       @    ( 8 `  8 X P  XeXU0 SHED000$%00 1@ 0$S0000; 40S 64  T R000S  B P0@0 0dL ^hT4H HD0S 808 4040+ 330S0S 3 C\P00AtCRPl30S50S2L3-(0S (3S0S  B?P00c00@2T20S0S 2 p\b\R0 SLB000("00 1@   '-000_ A000X!0S00PAPUL0s !ۤp., 0軤0P4 - 0Pq+ q0S 0n `K"0Cv*K8:00eK4 0@{ &ͷ0!cK8B>K0C![K8B>K0C!S*K8(R  K4 0@sK4K8P KDK P@P$`p48K@ P`pDB>K0C Z&偷0 K4M&tB>K0Cd K0@&g8 40"-g@4< <.`.x... do -QL@M P $d  哆~D\< .do" p-L@PM`00  00 $ $0P0 @@ 0t0 00p p-PL M0S p=`@T8# `4P@`0=0. -L`@0PpQP@ TP -`L!M M0 4 PPb ~KpG+P $ #P ZX ~KpG 妔PP 0nS. =fP0`0@Q P Q0 R# PQ 0 ,S 0g ZCa 0 00000oSP ,hs6 -L@K KM 0K  @@P -L@>K KM 0K  @@P -L 0K@?KM K  @@P0 -LpK@dMjPh:  S @ 0`0S 0   d6|6 -L@PpMQ000$K $0T` 0S l0$0 W ` X\0$0T {-0"S `vV#J$ 66T6 -LP@pMQ000$K $0U` 0S x0$0 W l0Xh $ `0l{0"S 0V`"$ v6<6 -LRP,K`(PKM0 (0 (  , (020#pPl PWx 0{lMX0S~PS 0xPM 0@K0  0~P Z0 0\ W {[P0  0@0 @bP (00  5 0$00 h1 0H><:,6P@ Z 0S *P W j40S PW z P 4@K 0P 40@0P  0P 40$067|.6 p- L`P@MK 0TP 0S 00 p0"S Pu -QL@M E  00 0 0 -0L S@KMq=p0  Qq$Q _00 E  0 0 0 0 Q0-L$P@100PPjE  eE  0 P 000 0 0-L@PKMmp0 Vh0d ;@ P0)00cHHp $(K 00 0Bp6PdT 0@DWF0 (K0pW C0 S;*(0K  B0RpW0DH  D H   0*0 ppP -LP`CM@T @* PKKKJK  0Ξ@0 , 0 I@0S0X , 0 =@0S0 0 @@ԈL -LM M fP F JKBNKI@DP` P 0/S 8 P +Q 0S :S S|00 0S S:Sm 0S0V0@ 0S /S ᘭPT 00 %0$?P V 0S /S _P= %Pu@/ U,ZnK`F@ppG`FZKtJ 0ᬥ 尕 @P@ 0ᬥ 尕 @P0 0逭@|@@H00@P@R @ UPE"*0S|Pp +0 @ ?0 jR/00Ĕ? j0R+b(][W LLԈLDL -L@pPM$p &P` 0 $K80+  0 S h0hPs 0:S  @P$᳝ 0@꼪M -L KMP0 R꼪 -: LP00S꼪 p-L` K@MPP"V T 0S:f 00T0 00e0pG 00pp; 0T0V00S 0 0 0-LP Md@0S ZP 0&PK(K(K'K 00Z\0$K0$ 꼪 p-L0K P`MPp @T 0  C0R*P0<0 P@p P p 0 0 0 @ 0pp p-L`MPP  PU @P Uph p-L@`:PMP 0aV@@ U 0T   U00d0p 00 08080 0 080 p-PL@`PMp P00 R\0aШ0 0 R R0a _p$P `p  00Q\0n  00Q R0nss -<0LP`p @T  0SQb $ 0S R l"P@T <0@P0P TP` 80  @T 0rsss -RQLp`Mpђ\qXfPU0@,H 40A0P 0U0 00 GP 0P0p Ur,0A Q P  0Q  $P U0S PU p 0 S a\$@  0 0\@  nT@ PU 4P4 0 P0bU(00@,,A000a!(0P2 U0 ,P g,0P 0^ --L 09|s --L M/ -- L,P 0" |s 0--L@,P 00 -@RLp`PJp @TZ p-L@P  0M< 匊P` 0 MP00p -LM808H@80 808808!$  0N 80880sPL Dr0|s 0-L1 R: 0X A0[][[M[P(P,0@8 &  0 00 00 0$0( 0,04 x05p06 cd0Q\0 0PP $rPrss`ssshss|s0|s-  0 |s -L@M+p h- ,0"0?30808000800X|sU0|s p-LP@M,1 0Q`+1 ‚ P*0 S" q!00c@C 000D 0 H0 0 P:q !00c C2+0`V,p0SD 0SH 0S0 r -L@M!P80@080 -L@ 0M@@@ @ p-LP@`0M< ` @ @p|s -L`3$M!3!3p!3!p|3 !h3@!T3!@@3!?388S@P78?3@P88S78?388S78?388S78p?388pS78?388S78?388S78@?388@S780D @@ @C, P4p 8 0 < , 0BPp, H ?? L 1 H00PD00H0 0L02D00H0 0P04 ??@ D00H0B 0PD00H0 00 R. 800?#  <0D0 0H0 0< D0?PD0 @ H0@ 0?#@ D0 H R D?DH0 0),0 R80  pss -L<0^4 ,0\  tsPL s -L<0^4 ,0\  sPL ts 0 |s 0 |s<00?#(DS( R0 ?30H0hl -L@p0 R ?388S0 p?c`H`P U0P,\!001  `0P PU8)hl<0H ?ȠQ?Ƞ 0 \ Dhl@-@00  @=|s-  0 E|s-  0 |s-ȠLȠ00 |s0 ȠLȠ |s0  |s0  m|s 0 |s-Q@00\@0?3888C$ 0 0-LP@1 R/   1 R@0;@0  0 R@0:@0  0 R@0:@0  0 R@09@0  0 R@09@0  |0 R@0;@0   ?388S0 -@srrrr(r4r 0-LP@0 R  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0   ?388S 80 R@078@00@ss p-L8@ #hPMe?38@ 8S?&p O 0- @LPF?38@8S 078 8-L@@0@?0 R0Q@0s0  F|s C-  0 :|s -L@M00  |s -LM p-L@P`0M `p|s p-LP`M@(p p ph R0-LP@ Br 0 S  Br 0S 0ht |0|s0|s<0 R 00 R$0 R @0<@0sr -L@ MP0 0 -L@ MP0 0 0-L@MD0 0 4PP0 00r p-L@P`0 M  @pr - R00P@@LT M0@r -L`pMPϠOQ  c W  e   PPP T `(@@$p$r,p ,0 AR0`0 Q0 d0dp \@ 0 0Q ,  Xsshl -L@ M@ -LP@P` M ZQ   cV   ipp\ Y   Q  Q  BDPp  0Z0  P$`@0   0Qr -P`Lp 0 0bV(00@,0A 0,00l(0 20 `)@0V -`R  LQppWMP,0 pP@ {P,s euP0k X4p/ 1,00' 0 00<0 0D0P8 P P$`@`HTx1 0H 0C YP0L 80780l X \ ` d h I<P48 7Pp) <0 R 0S  0Sp\0, r40Y000  0``\ 4u0s,qo0k,ighl-80E8| 00S^080P D 0^  0S80080Q080ss p-L`@PM0 48C8@J0 4S PUZ0PU0PUph -LPMA2U`AWJ p p` G4p0A F4V 0` V00  0ƒ` B4 p0 P 4  0 R S|S -LpP`M 8C8 J"A08C8S S `VPZ0S0 `B0C 0 0SQ -[=`$0LP9@p@T@T 0 e0T0 2$(B 0W00 2$(B@TP -@L`BKHp0MM@P@pGH%[=$0t0@p0@l0@h@[=0Ϡ0 , ( P1P U M -LP 00 0 R0EZ|T - LP !0Qeڑ$T -L[=$0MTğ, LdpD0 48C8X$00C0S0PӤ0zbM 8@0Sfu] XW# ?#>0 cß3Q 00 @ 048 CȠ$?R^LS 04S 0 48CȠ\p  0R3  048C'0Ÿ/". 0b"S000000` p 0`0C$ 0u ,2  0`0 C$]P ptS_ SpXW ,\ 1d, p 00C0S0PӤ0@1bM 8@0S0 @',    P1T0`A$P 7 ,0 0 ] ?#>0 c0Q Q p ` B4 0 u T P,Q  ?l#>0 cRP )0 0000#4 ,0㻐r PT|0j|s-  0 |s -L@M!p hT -L0K [$M # @r -L`p@P0 48C J–@P 0 P PU@Z0S00 Q- L0[ \$ (0 0 0 r -L`r8 0 P 0 0CR  0S h2 R 8= <@t5 T,  =@<0spP 0SX[-4  T00Q00S @ Tut  pP <p P;p@4 ,00C0S0Ӥ0( bM8@0S 8C8 @` B4 0@ @` B4 0 < q & 00 ` B4 0 -  Ƨ' Y w)l0 0CRb0S_ r -L0 pr 0-LP0S 0S  0S 0,04P @TT<0P 0S PR000 0b8080@0@080 0-LP +0MA1 R>0< 0^0 v 0:0 ' 1_0#-d!\1| o0!1 0S  0 0S80 10SQ 1 R10[=0 0kpL  11 Rp0r p-LP \Ml5Q [ 0 F@ K!`\`Tp 8#8 "($0 V0 0$0- EP  X~$=P  P~ P$0$V0 40S0 0`K?@@qP000+1( `1S0V0   )0[-S8  0S x1S1S 1S1S p0St0S 0S0S\[M; @<P0|4Qq[=0( [M?@3CP08t[M?@3CP0VpP 07;<0Q4Q \Q tP[- 0780tP[- 0?;0t|P0<0_P 07;<0tQ4Q \Q cP[- 0780XP[- 0?;0OP0<0P[=0 *P0<40|tQQ 4Qu \0Pn[- 04?;0h\%P[- 0<0\P0<0[M@d Kd` PdKPh hK P)hXhptpp@4,$ tTp|ssx0@-P$01L \710 L0\\0\P0 \0\1S` 0\04 0 ([ !0 8[M @ t0 [͠[ `0 [  L0 H0 @0 800ss ,strprrrr -0L@7`$KML0"0KHQ $ K[=0 # KVL00L0 0S\0P`P $ K[=0 # K.\00\0 0S1``P $ K[}p0#0K101 0SIPU1t1 PPQ<1PQS!R1!t1xTTT`U [=0 pr 0-L@P0 P jP00SP U8 x p  NP0mSP S000 0RP 10CSP;R P0;SP 00C S mR 00B;R SPdUhUpU0S S0S p-LM ` P 0@@DN e0f @Cp@-@ 0S:S |S  0S:S |S|R R:R\  |R  R:R ~T00|R00S  R:R ~T00|R00S00 0 )r -LRMppbQ  a W g0pSc, 0 P,C0b 0S00a CP;0 \0C 0, 0g 0S00i0C 0 W)020 8 40 ,,0 !08 @4 0R`` TP 0   P @T pW 9  T @.T 0 |s@-@00  @|s 0-L@Pp0 0h -0L?#0 KM0   -L M0KKK/- 00 $|s0! p-L@P`0M `p|s p-LP`M@Rp 0p ph -LHx@Mp, Q `0FSf x /. bp btpp HxpL\pp00P0Wp/ ,0 VQ @?# 0((R?388S0( 0 0R 0R  b "D0 H 00C\00080  p p  0  |s-  0 3|s -@LP80  Q E`DLVpP0V  e@ ,0 T  O00S0ssQ-0Ra\P L$0 R 0 Rrs$0 R 0 RHrs 0 |s -QL`@ME _L0\ P \Q 0lV`BPfU,000 0R004PE U0PC U0P,1 2D  H 0PPE U XPPm00C 0PEU "0l0V`L0Q`fP QG 0aV`pfQP,000 0R00)PUWP0P,1 `bD00H 0PPUPU00C PSU "0a0V`E-^p0\`j (0(,@ 0! 1\^P  0S 0  cP  0S 0  c 0|sp@-,@ P 00CQp0P0P1 0‚\`:0C p@0 S v!0 0cCb 000D 0 H0 0\:00SD 0SH 0S$0b=00 ^ R<or -LM8@p 04 50 rss -<LP^M@MP0 @Pj^<_}^< `L@, (04 \00 P, ]4̉44 ) 4   00#050<40 |80 8p00004 0,0F?08 00 0-80 0 R<<0 8, , ]= 0 0 @P0 @IP b000 0PPss 0-b=L,0@ R$0b-0 0] 40,SP X00Q @PPP03rPr 0-b=L,0P R"0b-0 ^0]M @<0,S0 L0 0Q@QP0rPr 0-b=L,0P R'0b 0] R@  < 0R40<00]͠ 0 H0Q @P@@0r -Lb=,0M@ R20b-0 0S b=40 R! <b-0Q4 0]<^=40<0 0]͠ 0 P0Q @PPpr -0@LS@My0s p 0b 400 r -Lb=,0M@ R3b=00 ]]}̠_]_m]Rp()P`  0000 000 000 <0Q @sP!r -Lb=,0M@ R0b=00 ]]\l_}_]R(P)`p  0 0 00 <0Q @2Pr -Lb=,0M\@ Rb=00 @Rˠ()@  00 r -b=,0L@ R&b=00 k]͠[] |__R`P()p 0 0 0000 0000 0 0r -Lb=,0P MA R@]= 0_-00 b= 00, lp ]]_R(`)p$  0 P 0   P 0 ,0 P0 H000Q @፿P9r -Lb=,0M@ R3b=00 ]]}̠_]_m]Rp()P`  0000 000 000 <0Q @GPr -b=,0L(  R0 r -b=,0L(  R 0 r -Lb=,0\!M RN<0,0 ^=<0,40 ]= 00 [-<0 b=, 008  [] [mR480P4` ,000 40,_=  @, 00@04  `00_=@ p8 pPL0 <0Q @¾Pp0r -Lb=,0 M0ap RE< 0,0 ^=<000 ]= 040 b=00 []R484P ,000_=@00@,000 _=@,   h0  PP0`40Q @kPprPr0|s0|s -b=L,0`q R:b=00 R \_@]VP@  0 1! 00]͠ p0Q @P 0 1! 0rPr -LKP@[}kM0Sp `0 0 S0:0Pˠ  0 .90 x0p0 X008 @0 b=,0  (@@ssrL lsDr b=,0Pr -L0 sr -LD0b=00 _R( 0 @Pr -LX0b=00_-Q(  40 Q@wPr$0b-0 0_-S r$0b-0 0_-S r -L<`K,pKP3@ M: <0 X8@ 4@ 0@ Ui 1!B@6&@\/.?>^x6 00R00S1L `T `R b0S0f0SK PI&5 0S5 ?>1e!B@@0 Sb5 R 0R-u0S 0R%0Q T 0R\5 RP5 RD5P %m0S EP $c00000帤0 R D00\$ 0 M0Sl{0S|4 R000 Sl4P,4 0S0S$]ğ00C\0 " 0Rʰ 0S ڰc00C0#0Sp< 0Rd0S X#0 0bS<@ 0R), R 0S00C043,0!2@ BQ 3\"  0 S 0R|"0S4000 @<0T8" X20S @ 00bS2 Ta0S1 R 1P !!0xT@00C\p! 0 P0 S,|p mkN6 f c `(1P q0  c B00SR0S Q0 0C 0lQ ʌ0 R0 R @}{H`0S8040SೈsPT`dsX\ r8- sPrps1ssLs\s`rssss ss -pLP<0@P`Pf@@`@s0 R|0 Rp0 R d0 RX0 R L0 R@0 R 40 R ssr@rHssdsXr0Ps -LMU 6 rv00 6u@R0@0q0  5  ?%0Q05Q5 5e堅 0P,0(Z5PI5 R x5 R[-0 \5 R[-0 @5 R[-0  $5 R 5 R[-0 [M0@0$0sT1 [=0c 0<0 0<0 0;0 0;0 0:0  0:0@ 090 090  0800SC 0 0S 00SSSSSSP0`  0P 0 R6666& 0 P&&&&0R 0?#(("'@460`2@DVƂF0 Ÿ0P- p2 P$ H ?388S00H0@0T ^,0! ?388S00 0  ^0@T3`V0@Tp 0^,0! ?388'S( 0^0@T0 0]/00T0 0K? 0B0 090/00 Lx[- @00@0T ?s`sslTsrrr@rHssdsXrrThs,rPL p-L(@Ȱ!M"H^J|1 \Zp1(0BȠ\TXESQPa[=0 R& 0& &64^-   0@Ƞ1RND$&Fp 6 4T 0LS= = <> D> = L> E80CS> (= $> ,> (= 4> @@@@p`sr@0@-@PJP1, P06A$[= 0& $B4Q0  00 48C80CS (? 8? ? ? 8? ? 0 0 0 48C80CSt? > ? ? > ? 0 0 0 0 00 0 0 00 r(8@@-!Ƞ"#H JD0 (0PLdNtDTScsCr@p@-`@PJh0 (0P3#$B` #34C034C$ 0pr 0-[=0L HQ \!Ƞ& 410!QL@@@ 1 ?#0(("7F0 R00?8C80CSA A LB TB A \B  8C80CS,B ,A 4B 00cpGVXp WcWʺXppGKptU0Q0,0!00!0 p-L@`MPTP@p Tp 0 0 0 -`QL@PpW  ,0( P00P0( P00P 000@T00C p-LP@M`Up00C PU@-P,`q( @! 0S1  R@ -LX0M 0 CR @000R@  Tpr-0 CR 000R ^p-  0 |s?@-@0R@0^  @ ,000!000xUQ@-R+@00 0 ! 0 !0 0 ! 0 !0 0 ! 0 !0 0 ! 1N^ #^ @00 0!^ "xU -PLM @\  0S00@0@@3 -PL@M  R $\ 0S( 00B $ R-LPp 80S01R``V P2 \0(` 0` $0S0($0 P W0pg ` 00GS`@ 0 STp'P 逆 0  -PL@M PU 0S Q``p 0 S񟗠xQ Q tR R S DS S S PT T T $U U U 0Sr  0C 0p 0 R0 40 PP0 #20S300 RQ 0 B00 p00kP 30 0000 R3 0 B0 p0 0<00 P0 R" 0 B0 p0 0800 P0 R 0 B0 p0 040 P R V |2 00 0 B0 0 0000  00 2 0  aVpg wa WpW  P 0S0p0 0 R 0 B0 p0 0<0 0 P0 R 0 B0 p0 080 0 P0 R 0 B0 p0 040 0 P0 R 0 B0 p0 000  R t00 00 000S0S 0%p̉|YYYYY P-L@P`p 0S 0S  00P 00 #53PB0e`  00 0S p-PL`M Qp0 S00  \p @QP0 R Ra\00Q00S0 e0Q0p@P 00@PpxYP P 0SM p-LR@`M<00 0BSR 8P0(U 000 04p <0p9( $ -L`p@ M( P@Z. ( PP$ ( ( P P0 (P ,08($$($ -LpDM40T0 L P 00T\,0%T%0l0P`C2n \ x Z \ \ ^ ^ _ 0a a b d U X^ 0ePUP H@0 0RhZ Z 0[ @[ PE@0aPd6d0L0K4 K80K,KL80,04 P0a PE `P P L0 0cT04006ca ` 0P PE0PL 0 0c 9 0 `PL0 0cP  `P P L0 0cT4iU X 0ePUP H 8"(#8R RP `00S00~ ` 00 P PL0 0c7X Y, T^= Y @T@! T @!  T00d0S P d dT00T0 0S00T L4 P  40T0 P 0S, %T%, 5T0c0C2l ^ Yu(0Q T0 S0c0C2T%a 00(S T Q0a0C2T%a U X\ 0eP UP HI $IR@x2Pt0LL@(  P  0000&gPE#50Y*U X/ 0ePUP Hş 01aPE0#50P:Y Lş0 S000 L$0 P0@0@" 00<0Y(*@U *X 0ePUP H:1 0!X ^@ 0 Pd6d  @20  , Q:00@KDK $@ HKL<0K @< @ P@_L<@D H0&Pu L ( $00 `PL0  0cT0P 40#PP 6L4T P 00\,0%T %0l0C2b 0LSP` 00T0P 40L00 SP T b00 `L0 0c PP T43LP /p `P P@ L00 0cLL ( $X X0RB S U *X% 0eP0UP0 H: "6d 00< 0PdRPl6l@ X Y00RQ X R  1 ^ !L0 ($ ` 00 P PL0 0c0+pP L ( $ 00 ` 0P0 P L0 0c 0 `b8ZLZYzlZZ 0- @PL(($($$($0 0-@LP((0000400P -L` M040P0S p,0, W`P 00  80Y @1@!S   , PU00Ppd0(Pe0PW00,  c4P000p000<<0 S00  0-L@P M0P P@0 -Lp` M \, P@  08R1S P$ 0S$2 0(``$0S2,$0y0EX`hSQX00X0S  Y00é?T00ä? Z-(8  PZ  (0Π0  LL HD` Zmp`(00 0A,0$ 0P (  0$(  8D( 030 <( 00!S  80S <0S P Z-00 0 ,  |@o`$0*  逆 `[ -PL@`p M PQU 0*S 0V0$0A?C0CV` 0cp 0d`@T``F4` 0P , @ L00 ,1#0 0@0,8p<`0@ ,0!0  0 H0DĠ@@@40T P0-L ! @T 0S $0SP 0,0PPPP P R 0PR* q 00 006 0 -PLpM  X qp? W0SR|@P`0 1!\ 0ST 01 `@P0Č4xt0|p ဠ/|@Z !40 0 0-LP0@T@! T0   0d0 0d0 Q0  000 -PLP`M @Q00T0SQ 0S 0S0S /0V0 Q00S 2  0Sw *Q P `} 0Ss VRVi?0Qb Rl0SV ?0Q |0,"0!0@S?00P00PppW 0S0 0P V0S0!a0!\d 0R0V V  0 V PP0 0D0<0 C0pCpC ! R 0 ~2P |0( 0Cd&0S0#{BsQ p`q0p0 d0S000e0!0!`[Z P0-L@8 Q 4 P*UqU ?0U,0S#<0S80S00S($qU000($($($($0 P00-QZL@PU0Z-8 ( P`[ Z-8 Z $@(  0$(  8D(  <( p0Pp3 80S0 <0S- W+ $ 0 $ 8 8|D < <ws 0 a@ZΆ@&] 0(ˆ0@+[0 0*00=0 p-LP`M@0T@!T0dp 0 0Q  ; 0 00 p010 -L@PMD0$<0 C04PCPC|0l01 `p0 Č4@Pxt0X dPTPlPp `PZG-@$d A?@0CR0M 00`Ap0`p0Pp \ 00S, 0 0l t.!S0! 08, 0 S 00 Q^\ 1Ѝ 0 S0R 0R 0RP 0R 0R 0R 0R 0R 0R  0R 0R U: 0e 0 1p  0 !Q  \00C0 0 Z$$b RcE-p`0T10⊀p ^  @ 0^T\ ^ u*t:40C$u*t:U ኀ \p @Tp\ \ u*t:40C$u*t::0C$*: ^:ռ:00C$C$*ո:ս*ż:G-P M04  0 0R ^Z 0 0  1 000 S 0 0SB \VZ=q৮040v: D0d\`9u*t 04< 0C40 0  00 cP0@$0C 0   R  \  0R Q Ѝut*0$40C40 0  000 cP00C@$0    B ZM4@ 0n\Z0 04 < 0C4 00  000 cP0@$0C 0 Z4P$0 0L4 00C4! 00  000 cQA0C 0R 0 L40C   00C  8$#8,B4 00u t*0$4>C$ 0{ \eʸ ZM4@ 0n\O 04  <0C40 0  000 cP0@$0C 0 Z4 P0 0L4 00C4! 00  000 cQA 0C} 0 L40C  8$#8,B4 0 ZM4@ 0n\O 04  <0C40 0  000 cP0@$0C 0 Z4 P0 0 L4 00C4! 00  000 cQA 0C 0 L40C   8$#8,B4 0 -L@M+ +&D01wv*@PZ= 0    0] -LZm4`Pp M ^, Z̀0 0A4AZM>0@0C40! 0  00 cQA 0C0Zm4` QZ 0 0pG4ZM10@0C40p Ƞ0,Ƞ 0  00 c\ L 0C0Zm4` ^hZͅ0 0I4ZM>0@0C40! 0  00 cQA 0C0p W+Z=@040@ ^`,ڨ1 !wv 0 4> 0C40 0  00 cP@ 0C 0p W, @"0 &o01w v  $.B4 `0Z 0 0I$.ZBĠ00 0Z 0 0pG41Z-CĠ0 00p rZ 0,  0C0 0  00 cY"B 0C 0 0ЍGP0 $.B4 0E-Zm4`Z}0ZM S0p00P0@040C0 0  00 0C0 E0 $B P -LZm4`PM ^Z 0 04ZM>0@0C40 0  00 c\ L 0C0(Z}4$4pd0f^Zͅ00$4ZM>0@0C40 0  00 cP0@$0C0 _Z-`4`, 00n 0SN ^bZ 0 04ZM>0@0C40 0  00 c\ L 0C04$Z}4pd0f^1(Zͅ0 04ZM>0@0C40 0  00 cP0@$0C0 Z=,0  Z 0 4$ 4.Z0BĠ0 0Z 0 0$.ZBĠ00 0Z 0$4 4Z-0AĠ0 0nZ 0 0$.ZBĠ00 03D] -LP`@pM|\0S < 8eZ$ 0 0 P0V0 R00SPF Zm4` ^2Zͅ0 04ZM>0@0C40! 0  00 cQA 0C0 + 0D&-hW iZ 0 0$.ZBĠ00 0Zm4` ^#Zͅ0 04ZM>0@0C40! 0  00 cQA 0C0hh Z 0 0$.ZBĠ00 0 0WkD]aG-ZZ=` @0PpZE$U0P( 匐pPE 040C$0 Z- 00CP  Ux0$4h404C$$1Ѕ0ޗ1&̓U31Ӆ0ޗ1&-0 40 C$ 0 0@0C40 0  00 cP0@$0C0 $Z=$,0 Ѝ 0Z 0$0$ 4>Z CĠ00  0 0$4<C$0P3 4$Z4t 0g^ 04>0C40 0  0 0 c00CP 0@$02^ ' Z}4p2 n\`a 04 <0C40  0  00 c00CP0@$0 JZ113 ӗӅ00 Zm4`0n\C 0 4<0C40 0  00 c00CP0@$001^  Zm4`1 n\ a  04 <0C40   04 < C 00 0$4C$0U^(@ 0 *0!@0\ J^:!@0\J0@T@0p@D 0@Tp@0^!0,8A0@0T:( 10Q@80Pa|@<@$@@,q ! 0@00Cs ,0 `Q,   0$ ( f Q !f0.P$R$,0l  C^0  *^*0 R c^:(0 >00ZS$! 0| $P0!0 0l <40 `¡n@ `P ,8e1W <?0## *4 QN*Q` 0p04^ *1^: 0B @$ 5@$0C 0S $ APb5!$0C0S,@p,U ( Q E(0\0P00SЍ40l!P 0 $ -L`@M ,` p( PU0  ,K p`PxpD0@0 p 0S$00@($ yy -L p$M0 , ( P` P\P   ,Kp`1=P@0St0 t0 0@($0  ` ,K00P@ 0 X00R00S tT0 t t @0<0@($gfyyhgz4zXz  hx -L`p M@( P P 0P0`p -L`M4040 , 0 004\, %4%0l0PC2a 0 S񟗕ꐺ T \  L X <0^ Y]0 00 0 U *YE 0uP U0 I:h& 1 01 R0 Pa7q0   0 0 00"30# 0 0 p 00 P0 ,0 0c504040ow 010,0 P p0 0c pP, 0 0c 4  4 0@J44 0 00, Q40%0, %0a0C2c \P| \ 00 p,P0   U *YK 0uP U0 I:<4 !0  00Pl7|0 U *Y0 0uP U0 I:# 1 01 Pa7q 0 0 0 0"30#z p 0 0P0 ,0 0c<3c pP,0 0c0 m U *Y 0uP U0 I: 1 0 0 Pl07| 04 (@cT*, 0a@T:0S ^, 40S4 ^ 0400 N4 0, 0CT(@S0040 4,44 0 4 0R0b0, %40%, 54C2c \ ^(0Q 40 S0c0C24%a 00(S 4 Q0a0C24%l ^, 40S, ^ 040N0 4 40 4,S44 0 4 0R0b0, %40%, 54C2c \ ^_(0Q 40 S0c0C24%a 00(S 4 Q0a0C24%l 4 U4 PE0 ,J"4040 0 004 S00 pztzz - L(0$G-`M04p04 W 0 0g0C20 0 0 %,0%g a@@Q0QPE 01^&0 0b0H< U  0X00S40 !0`eV`!@f0@0cAP  4p PЍ .30#b07 1 0^  00 !0`eV`!0@f 0c0 AP@400 !`eV`!@fA00c@4pP  10P 1 n0Q`00QPE 01 .30#b0 1 004 !0`eV`!0@f 0c 1AP@4pQ*0QPE:1 0 00( b Rn0f*,0j R:bV `n0^00( 0`V0<00`F000`V0200`F000`V0(ztzz -`pL400PU,0@e0z  T@! 8T  R0d\04 ᨾ,0PU 0P4 (PR 0@e4PT@!z  T  8R0d\0 ႾP<  <0<  <0 -L@M <0 4Q?0T =PB.0Rz||ݷQG 0`2D L P 0QXl20l20,804 40S80S -L`MP VXڪ? XppWZ$Z\1$0(0S1,(0  PP3 2h111C2,0  `@ppp,$ ,$ ,$Q \ P,(Q Q,(,(,(, 0B  H0 ph0lrdr$ (p,p Pp ppp] 0@-8PU4A`!,.1P4#`240 0UX 5 $UD$  D$ 0T0D0$0D0D $ D D0$0D0D 8$ AD D00D00UD$ D0$0D0D $ D D$0 -L@M40Sh -L@M0SE DpH0W?0S; 0S8 04P`V- 80S U04`8000S0 0A0 0 0 0C 0m`4H1 .!$$"0X`"4`D00D080S0DpH0W0S 04P`V* 80S U04`8000S 0 A  00 0-`4H0 .!$$"0X`"4`D00D080S0@-@0S P L0R,0 @P00P000CQ 0  000 -`Lp @ R' R@0S` 0S D R0 R `F'0 0QP L0Rp0S  0PSP  0S 0S P0-LP @T Q00CS| $ U U 0 U 00 0000U 0Sv 0S  L0P R0000U 0S^ 0S P L0R00 P0-L@" PU 0SQQQ, (0 00,(,(,(0 p-L`@PM]P * T* V(U&$\0$0 (0S|0,(0t P  0   00d< 00 00@0P(`TPP 0S 000S\,d<S0 0\,d<7K(0S+ <@0 @ Q  0S`<0 0R`<R `X<Qd< ?0#d< ]8X$X,(, K0 0A0|؀  P0-L@" PU 0SLQPQTQ, (0 00,(,(,(0 -L@M9p0 0 -LPP@ MpPX 0JWSYT00 0#3`AO PP5 O N=, T O 0` `00 <0W `p8O=, `N ``  00 ` PN=000, T$T 00T0 -P@`L0M0TO=0  00P0S\QZN=0 R V00T O=0  0 @ V00O=0 QO=V0N=  0N}NOp(N= $ 000N͠S 0N]cP S N=00SV0 00尦U0 @ V000V00TO=0  -L@ M@ -L@QpM , 0  N=0 RP00O=0   0#30 W00O=0 X0Z0Y00 R0,0S1O- 0S%N< N=(0<  8 < 40 4N= 00$ <K 0`0FN͠S8G4 0N]cP S 0V,0S 0@! XN=0  ZN= 0  YN=,0 0 QN=00  W00O=0 N  .o 50 @0U0 @ WO0 0 OW``P@ -LP`@ MP`Y00Z0S, p,0S 0U0W00SN=0WUT00  0#3NO OP`C N=O-T 0 00 O=8<U 00 0PE U0 N , NP N= 0O0N-0  O=T0vT 00T0 -P0L@M0T N=0 O0R0 P0000O=0 RhKN P@ -Pp@0LM0TO=0  00`QPWN=0 R V00TO=0   WVpTO=0pN-0$0O=( 0p,0 0@UN]P0St4 N PPP'P U 0S, V00VP 0c,0PU N=0 R 0S V000, 0V, PN-0 bV0 @N-00 V000V ,0  V00TO=0  Qp@-P`# O0S P0000pV00R@@T P000P@N-00 @pP00p -LQP`@P4M  UQ ڢ? Q0S?RXPPXK0 4 0 , Pp0 XP H` T D0 Pp P U0D 0b0 M I -LQP@`4M  R00V0SQ00á XK 4p 0p ,p QPP0 X` H T D0 PP P @0D 0b0 8D0S 1 - -LNK(HH@pNM,MpRP*KpNNp`K3 pppspp1 (0K p 00S sSK  YrSp d1  00A00S81W4lE$iE*K#R8Y 0S.@WX@T W ZN K Z (@ 0@P`0T X0T(]N KNKK(@(L3 L@ p 7U@:K\\wSpz@4gH{ 0g 0b -LO͠K@M 0S0  0SS@@ -0L@K M00S@ p-LN@`K M\ 0P `g\ 080UX p Up \p`UKO=0 0R b  -̠ 00!^ 0`S0h<0l,Rh< 0|h,Q -LWM P 8  0, 0C1 0t1 ,00 000 400 800 <00 @01 <\01 <`01 LZ0@T0NZP Qh X z=<00,0 31 |̃  040  0 0CR0 00 0|p07 g0C1 | Rʐ@`1V& | '00 RP  040  0 0CR0 00 00 Bp320p0 p | !< b0Rq0!R` my-< 0 0|. |l@ @0( @0Rl@ @0 TPLh`KVzlP<@ P`l h` ?lQz.yx@DT|>{.zyNT 0{.@T|.| 0| ( @0RLhp0@0 PAQ|> y< 0^0y 0@8 AN ^0 0.Q|.y<00C S|0-pPa0 @0| P|NZ0PU0Z40Sh@S00@S 0`< @@pDD  040  0 0CR0 00 00A\,31$ \,100 QP  040  0 0CR0 00 00A\,31$ \,200 QP  040  0 0CR0 00 00A31\,0$40 0 \,0b8p, $PL lRO (`,p$@` 4`p 8p@ 0@` @`p Dp@ <@` L`p Pp@ H@` X`p \p0@ T@` d`p hp@ `@` p 00 0@ l@p @ 00`pK00 000 @`pK0000 000 @`pK0000 000|0X2\2\2S["L,0 \L0X"A0$QL0X"\@-!L\PL[",0 \L0X"@0$QL0X"\X2 `2Q.(X2@\L[",0 \L0X"@0$QL0X"\X2 `2Q.$X2@\L[",0 \L0X"@0$QL0X"\X"0`!SX"\2L[",0 \L0X"@0$QL0X"\X2 `2\X2-\P["L,0 \L0X"@0$PL0X"\X2 `2\X20T0X0ST0T 0X!T0Q -LPCM 4! 0 (`T 0X,1 ,0Xx0@T(0KCX0D X Q01 S @400Xq(1[S- ^N O |2儐0@ |20N^?(1['[I/KW'1K B 0W0(KJ?K c|2 BĠ0 @|2 X ^Np  |2p0@|20N^?,!x2 0B$@ x2tBx20 @x2 x20@x2 -LMh(P T00|0 p L| X$ |P0XpWtbVtb tXӄ t^ tKQ t2S000 @ThbPpthP pb Yڄ3lh0`Fp 2 b ᪚h`LVl |N\ ! x2`l0V0l0 Sl@K0脀WT W  g?0 cR1@Dl@ x"`bp\6| X "l@K0X00X00S 0| XBl0RpG0@Wh0 fB ptp pW (0KppW$ 0Rp |X3|1` X0 pW0S |``px` p` h` hr ht X=1 ^Lpl l W (0KppW C C0 R hlP ʌ@0 PUd \Lp$P (K@ \ \0$ B4pW 0L Ll`Xڄ1pe@W6 @ (K Q 0Q4SpW(K 1xP$ p`@  `PT$ p` xP  lPK Xʌ3̠`` 0401 lp X lh lpK0h1S0 Ìh"0000 $hB !0000000 0$ !000 0000 0$ !000  0000 0$ !0000000 0$ !0000000 0$ !0000000 0$ !0000000 0$ !000 !0000#0" $ !000$%0000& '0$ !000()0000* +0$ !000,-0000. /0$ !0000100002 30$ !0005040006 70$ !000890000: ;0$ !000<=0000> ?0$ !000@A0000B C0$ !000DE0000G0F $ !000HI0000J K0$ !000LM0000N O0$ !0PQ00`000R S0$ !000TU0000V W0$ !000Y0X000Z [0$ !000\]0000^ _0$ !000`a0000c b04 000\l@K00e1S`0 0 | ‰@p0 B᐀ |Ɍp␀0pɌ㔀P ` ‰\lP` P`0pP ` \`ɌP☀@|l`p P@ 夀 @ ‰L@@P@ 00@PL\P@`p@ l``p夀` l|`pP@ @ ‰L@@P@ 00@PL\P@`p@ l``P@ @` l`p开|p ‰L@@P@ 00@PL\P@`p@ l``pЀ` l|`pP@ @ ‰L@@P@ 00@PL@@\P`p@  l``p` l|`p@P ‰L@@PA 00@PL\P@`p@ l``p a l|`p!P@  @ ‰L@@"`#pA LK00QL\P@@ l``q a 0l |`p%PA $@ ‰L@@Q,A 00AQL\P@&`'p@( l``q 4a l|`p)P$A (@0 ‰L@@$Q@A 00(A,QL\P@*`+p@< l``0q4Ha l|`p-P8A ,@D ‰L@@8QTA 00`?pA cOK00QL\P@@ l``qa 0l㘁|`pAPA @@ ‰L@@QA 00AQL\P@B`Cp@ l``q嬁a l|`pEPA D@ ‰L@@QA 00AQL\P@F`Gp@ l``qa l|`pIPA H@ ‰L@@QA 00AQL\P@J`Kp@ l``MPA L@a l`qԁ|p ‰L@@QA 00AQL\P@N`Op@ l``qa l|`pQPA P@ ‰L@@QB 00AQL@@\PR`SpB  l``qb l|`pT@UP ‰L@@RB 00BRL\P@V`Wp@ l`` r$b l|`pYPB X@ ‰L@@Z`[p0B OK00RL\P@@, l`` r0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X"\QA @0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X" \QC B0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X"Q\ E D0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#0X"\QG F0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#pX"\QI H0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X"\QK J0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X" \QM L0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X"Q\ O N0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#0X"\QQ P0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#pX"\QS R0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X"\QU T0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X" \QW V0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X"Q\ Y X0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#0X"\Q[ Z0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#pX"\Q] \0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X"\Q_ ^0pL[",0 \L0X"@0$QL0X"\0l0gX" 0#X" \Qa `0pL[",0 \L0X"@0$QL0X"\0lX"0g 0#X"Q\ c b0QL[",0 \L0X"@0$QL0X"\0lX"0n 0#X"\Ex Qh2SL  d:)0 c4)L@ a-)L@? l&)L@\™\[",0 \L X2A 4QX2@L \0\2\™\[",0 \L X2A 4QX2@L \0\2b A = 9 5tK@?>1 (Q (@Kp$ t(pW@\ |@X2%|&pL&[, 0$*.P, (@` |PȌXpl`w5x |P@tw-x0 }P@h0|` 0(htp t  trtr OTD t20}(*Y@Ё|܁@!H 0-L@PMD^&. l ?0#Qd20L0`"h2SD0l"0R,0i ^E10A-Y*&'S$Y!`\P["L,0 \L0X"@0$PL0X"\0S\2["L,0 \L0X"@0$PL0X"\X2 `2X2\U0 rE8Pdhh2S0hNd"pp'CBZhp0D&> P'r|Ă -LKPQM M`$ *K\ `$U*Kd4 .K B B1S4<0:KP`4UK`+P`/ B0(K U0 8d Hl (pK(K!` Lp0 0T( K1(0K1 ,T (K1K`TPUAVV;/C*KKp4qp (K( K0$4:Kh(K4$ `F@q( K(K^1Q $ (0K( K1  ,P(0K!(K1  ,Q@(K1(0K!K44l4 ( K44 P`Fq( K(K^1A $ (0K( K1  ,P(0K!(K1  ,QPKh( K  ,0S0` 0!p(0K( K0*Kl$$P:K  K@p4p00( K 1(0K1 ,U @(K1VrʁX9K`PU;`/@C( K0 R /F(0K 01(0K 0SKK\d*K`$0PPUC^ R $KPB </C$ 4PU <}}#0@-R@P 0\ 0S \ R0A-P`@ pX ^0 S ^\ 0 1\S !00\0 1 0 1\ 0 1\X  1  c0N 1\\ 0 !0 b !\ -L@M!  H3 T L# L3cSLL (0K ! 0b SL X P# T 2l3c1088T3 厇PP1 P 1 P `P U$!1aP11P!P U !1aP1 1L!`FL U! 11P !LVL#RPh0aPPp`!1pGW1!l 0f`^ࠡ 0n^!1L\1!P#00hC fP3c 0nQLX( K0(K !L  PLX#(K 0!L  PP# 00!y 0 /Q -L@M M\& (0K P$0ZR0( K$ P$( K4P8 Z$ KBL0P4 ZP (K!4C P?=20P !P(K4!0#P!Z1 21  1P21Z 0( 0S^ P2!030(Q@P 048 Pp1 2 R 1 2 R1 s 12 1 2`LVC12 R 1 2R1S 1S  1"2 " PLUU4f   04 mV`1!^1<1Pڙ R704\00P0S0 r Q#^@( K0(R(0K  8S @ (K0( BP(^l! d0XX4(T$ 1s  g(,0(H$7  0$|H`x -L`M@n\, 0 40 0 S8  80080 1 S8@@T8@ I8 H XX1 @ p<0 Pj 4, 00P 1 U1@< X!;1 @ p<0 Pj 4, 00P 1 U1@< X!1 @ p<0 Pj 4, 00P 1 U1@< 0S800S80 Z -LpOM M H  % 5   cQ % B1(K5 0 % 射 X  0nS R  !1 0  1P00 RQ ! 1 @ P T(0 l^ 11@ @T0 l^11@PE@T!11@!@ U (K0  $  5Sj 0a^ࠡ^`n !1`FV 1!0` eS0S 0c!1L\1!%j n`A@ 0f bRd  D  D d  NnK@@0n fR  $4 4 `$  TD f0dS0 $@`4 P4 $ D d T   (0K(K %  ( KA Sa 5 %4 4 % 4$4 $s5% h0Se -LPM M`V, 0 4- H@TZ0@I0TtDM (40-04Gt! !@D@T@0Q4Gt! !@@0Q4Gt! !@@@0Q4Gt! !T4=4mA004Gt!@T !Z4@0=` 00 @!T4^l@1 01@T0 DM0Td+0 $&$("h1pCqDD,mAD@DT0Q4"<8#h!,pBq Q$#,("h1pCq0Q4"lpAqT 004&d!,pBqA@TZ@(0K( KD@TB0 0 PvP@ @@ ( K1p(`K`1 % %b$(0Ka0iQ@=Xp@(`K1TP< @(K1p W8 ) !1!06`CVh^t 0lh , 04-0@P <0  S<- 8=!8m61pW(K 5XS  (Kp169pW,060C=Z (K %9vW,-1S0E0m@0( K(`K0%SR9,-09p9W e0$(0K&=pBW, 1S E0 @0( K0%SR=,-0C=pG=W(0K -0AS QD R c p1pW61,Z0T5H)0$ &< j0RRSB\ p,!W884m#4!RA0`pWZ<0\S @T.\ <=|cp U< 24 0v} ! 0p})ꔃ|ăx -L'<`0MDp W0 $Ph0F" # PdPd@@8(K, 00Z,0coW@ oq@p P@00x ,0SD 0R001S   R0sZ 05 0}|<RA-P`0bSEQq\A !1T \  !1TA 1QpEQq\A !1T \  !1TA 1QpG-`Pp MQ(, Ѝp` Qp` Qp` Qp` Qp` Qp` Qp` Qp` Qp` Qp` Qp` Q  p` Q0 @0$4Rp` Q0 @0$4Rp` Q0 @0$4Rp` Q{0 @0$4Rop` Qi0 @0$4R]p` QW0 @0$4RKp` QE0 @0$4R9p` Q30 @0$4R'p W`0 pj V`j 0C R 0dZ p-LPM$`$@A`^010p8X -Lp@oP \01` %0S  ܉W00X -LdPK`@DMq P0 S8 @?TP@T d0[SP   R RE0BS AR "0 0@!K@ P!0[ S0FS ~008 -L[K@ k_K`uM ttŸ1s `VV 0@S:S 00@S:S0@SKk 0S 00SqA00~Vp" @yVp dp  P h@K!k?K@|B=p ^p    1}{T UT}S0P@@/{[P\ {K @0@Q1 0Q? {K o0:S  00:S0@0b0 00sfi8Xt|/ 0-LP,@t0 @0騄 -L`@K0pDM @Ap pP `V@ *X P`@ V: 0 0 ꬄ8 -LP\@K0`p@M @A0s  yd01@ 0S l0fX000괄X -LP@\`Kp0HMH @ AQ0s@0 o0O鼄 -: <1LQ@HM`; 9-< 1Q2$2p, SpP' P p kP@ PU0 48S P*0  P: 00 x 00 48\@KC84 @-Ap ,8Ȅ -:L$0S$ 0EP0  -p-L@`P0S  7p00p  0-LP@0S00hP p-LP`@M0SD  ph ph p-LP`@M0SD  ph ph -LP@p`\F 0 h 0h鵇 -L@M0SD hh --L@0S0D     x -L@M0Shꭉ-00 0-LP@0S0h~ꛉ-000 0-LP@20S0hzHꉉ-000 0-LP@ 0S  0h+0h.R --L@HP A b-0 0 -L@M40Sh~ 0-LP@0S0h:HC-0006*3*&0*%-*]**'*$*%!*_*\*;**9**8 * ***** ***Q*)*|*)*=**߈*"܈* Mp-L M0@0``趆p Mp-L M0@0``裆p -L KM"GGo -GLG KMePp (@-@0S  S 0Sd@! !P0@00A SӇ:Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R z갳+LR괳: Sb0 h Sc0 a Sp0 ?00 r0-00w0-00!=@SO FS-0A r0-00w0-00?0::+S / &S-0! r0-00 w0-0 0P<0 -03 : P P 00 t00T0x00 S Ss0S0x00 S ! Ss0S0x0 Sd0 Sl0  SA0a0-0 Ss0  Sw0 -PLPM 0Sφ0 0=0!PPSLp `KᏂP  0@! 0S0 A H^ -PL@1!|M 0 @  p`K@ KPpP l@ h@ d@ `@ \@ jOp X KdOp 9K Kt@ 0 |@ x@ Lp 2QpP P+ K Wp@o0S@  @K =OXK 9OK (@K -OXK )OK  @KOXK OK  0 KWH^( -LM0 , 1,P@ 010-T@4  40 +T@XX0T_ X0T ɯ 0 L 0 p`L8 80000@D, 70DW0D@T&\R QQ0 8T00S "0 0@ 0 Ỳ /R0040\00S q 00S \,00E0XSxS@P -L$M@ < 2K<  -L0K$M 0 ʄ000#00  00  ,KOP@ᴄ0"SX ,Q0 0b0CS#`   4 L t p`$K4P@W0V-, 0xS S. *S 00! :;p`0@K 00P0 P0 H0SP@W V" 000!4\ 8^ 00PK 00 00; U T 0 00 000p`/$A?p`%$K5p`*$F:0 p`P@p`!$O1yЄ  -L0 R0  䠟 `؀0Vp1Px@w0!"b2c3c0`cP@`0VT0 !`V<0< 0`1V $( 0-L@Pڃ0hՃx -L@`lq0hCɃ`QPX1  aB!!0  TDT$!$00000 !10~P0 00aC1100圃 ?T0 0 T|0x 0T\T 000 ,0,?0 sx ($, -LpM`@00C,0 HwP^wV̐P0  aB!!0 @ U唠0 0Uq@P  P0pwX0,0 D0! (,%x $$8(,0@-0 R@P0 4`14c021`1:900T0 000\00%"%*Q0%%0 , 0-LP@߂0x0 4b14c021b!*9  000 -L@MvP0 @vP0 -La`Pp M @`@e@vTP Qi !1\1!@T -L0pdM\ ğ 0000S#000쓟蓟#0S0 RW3 \ C ! 0-S4 3#0}P0-S" t}P0+S-S DCp00 0Sq 0 0 a0b 0 0000!Ÿ0 00S 2 r "0s 0S 0-S00 0@:T0TRa 0+S-SEPV WT> 0:S 0 R00 000 0S $0:S! 00 S!01 1 1R 0:S&|1@+Q-Q0:S :Q?:4! 000;S0 R00 S0100 0R00 R0000 R 0:S0?@tPt0q0 Xp 0 0 a0b0000p0s0Dss8<4@Ls؅ -LPM, p020 R =P`ph` Q@m  Pv @2Sya B  0V0R00S T2 R 0:S 8 0S $2  +Q-Q0:S :Q?:0BSV1`' 0 R Q 0 0R1 Rx1 R 0:SlK 0S L14  00C0R!,0!0 00 R 0:S*0 ? P y 0 R 0:S  xpft@ QlP dP ,0$ 0 a0b0 D4@ssp<8 -L`p@,Ÿ0S$RR0 R0 0!0P0 0-S 10 封0-R0 _ 0SP :Qㄡ9 P5 0:S l1 0SL!000 0S( 00V0!!0 :P 0 R?}0 0 0 0 00 R 0000 R 0:S }0 lP00-TP (0- 0S sHsDs@|@ R0 ?$ -Ls?KPpKM`@D0 DD0B PaHaLa0eKh0Kg KfKx0S tKd0 t0  ` l >p@ t0`dyP dP00 00xQ0  0 -QL`@pM RPPzPE4 0 p$`,@( P 0 0RPY00 -L@M 08  q0 P @0P x0 000   0 00 01q - 0 0 0-@Lp00C0S0PӤ0q0`(P -L\`KLMd ` h0 l d@ d $ h0 PpW39<Q U@* 0Rd @T<5:T ` 0 0000Pp$0(0,0 0 /P0P l0  d0SH0SR 0 P00P0 d@T  R 0D0S ^H0S0 p LP 0Sd P0S  l G  0ZP@ U E  0FPU 0> DP@ d R 0hc/0cOd0S^*hP@0D ^ 0d^P@: RPlw00w00T0P^  wL 00Dv P @l@ jH0Sc@0\ '4P$'`P }p -Lp M0W 1>3S` S 0>3S` ? S S 0Vp S SS S 0`P 0 P E, p@F  0@ PP, P , 0@S< S %S 0`P 0 P Ep@F  0@P 0 @xS S >" 0c O > 0c" 0`P 0 P E0!># @Bp0  @sP 0  @1>3p@!>#"R@D 1>3`DSB1>3`!># R9 -L$M0 ,   RP`pA>3Sk S S pP U00W 0PEA>3S ]SR /S+>s 0s  0@S , 0dV  u3P 0!R P1S 0sS 01V000C 00 0>30c a0, P00@, 001 0 `S< S>s r 00K0c O00, ]P000 KS>30@C 00, HP0!>#@ R 1>3@!>#"R@D a @ K>sB0 K000@K00, P00000, P>30  ,V,VZ  0R US S,V`LV VG*0 SD0@0 0V V0V5:40 SN S&S% S V V!* Q P00 _Q 0V$!V00 _Q00  V V*0V S V V00 _P V5505:00 PA >3PA>3 S,>3 2 V 0  -L0AϠM, 0QpQ |4  d0 0X00P4 p|^ ` U4 @  U W  Wt T e<0V  U; $"00 00_U00S  W !00   A?_W 0R` U 1  000_U0S <0V  W 00 00_W00S Ao`A?F0CS><,0X  R  00 pP4  0  @@0  @D`Tʍ0 0, <V``@} 0v0q l,@`l 0e -LAϠ0M, 00 0 QpQ4 |  0XP`p| U@  U W~  Wo T `<0V  U; "00 00_U00S  W !00   A?_W 0R` U 1  000_U0S <0V  W 00 00_W00S Ao`A?F0CS >240040 0, X ^4  0 0  @@-0  @D`#Tʒ0 0, <V``@ 0{0v l,@`q 0jG-Q0`A D P !>3S} > S9 S S S Q@3"Zp0   S S0ZS S S0>#0S S S S "S>0!0># R0p !>3 S >3 !>3 S&S SA?0A?0>0400 S2 aB0Lz -L``KTMh d l0 p h@ h $  l0 PpW39<Q U@* 0Rd @T<5:T d @ @@PprP$  0 00( 0 , 0 0000 , 0 4 /x 0 3P0P p0  h0SH0SR 0 P00P0 h@T  R 0D0S ^H0S0 t LP 0Sh P0S  p G  0^P@ U E  0JPU 0B HP@ h R 0lc/0cOh0S^*lP@0D ^ 0h^P@: R P$qp0$0q00q00T0PZ XqL 00DIq P @p@ fH0S_@0\ .PdPXwp -Lp M0W 1>3S` S 0>3S` ? S S 0Vp S SS S 0`P 0  P E, p@F  0@ PP, P , 0@S< S %S 0`P 0 P Ep@F  0@P 0 @xS S >" 0c O > 0c" 0`P 0 P E0!># @Bp0  @P 0  @1>3p@!>#"R@D 1>3`DSB1>3`!># R9 -L$M0 ,   RP`pA>3Sk S S pP U00W 0PEA>3S ]SR /S+>s 0s  0@S , 0dV  -P 0!R P1S 0sS 01V000C 00 0>30c a0, P00@, 001 0 `S< S>s r 00K0c O00, ]P000 KS>30@C 00, HP0!>#@ R 1>3@!>#"R@D a @ K>sB0 K000@K00, P00000, P>30  ,V,VZ  0R US S,V`LV VG*0 SD0@0 0V V0V5:40 SN S&S% S V V!* Q P00 _Q 0V$!V00 _Q00  V V*0V S V V00 _P V5505:00 PA >3PA>3 S,>3 2 V 0  -LM, Q00 ,4 8 (@0 Yt00 0AϠ00 @< 0@ 4u0Y04  `J,<P p V< P  V Z  Z U s<0W  V; \"00 00_V00S  Z "0 0   A?_Z 0Rp V 1  000_V0S <0W  Z 0 0 00_Z00S ApA?G0CS$0, Y00R0S0 8t0 4t0 80@@< P00 @p@00 @PEpU@0y 0, <WppPo 0h0c |,Pp^ 0W -LM, Q00 40 4 8 (P0 Ys00 0AϠ0< P0 P0Y `p V@  V Z  Z T 00 P@DpTP<0W  V; "00 00_V00S  Z !0 0   A?_Z 0Rp V 1  000_V0S <0W  Z 0 0 00_Z00S ApA?G0CS"0<S  4< +P ,Y 0 8s04 s0 80Pw<00 PpP0{<00,Wpp@r0l0g|,@pc0\G-QPp@M(,` >3 S E S@ %S S S ^@PЍ3 Y0   S S0 YS S S 000>0 00S S S -S "S0 00> 1>3 S 0   Q >3 S >3 >3 S 000z&S SuA?0A?00 00>a0 S00b0S0aPC][A-̠eLE@`pM ^P P Ѝ(P \PЍAEPЍA -PL`p8M<$ R R R @ R P@K2 s2rVP sP@K2 )PK2 @\ -LPp`X@0SL]P 0S0S  )\1PQ -pL`KtM } } P@h w:kPPo 0000kP b 0P@ 00 R @H@0ZP0  408@@ @p(@,@0@<@@@D@q H@0Y0C 02+ 3 00C$0z ) u (D<,E0e L0 PP ?  k lq@ -pL@` PR*0|S S C R*0|S SP1 R"*0|S0Z0  g\0 fpC" `Q  e 0dp`Z  f}  g m8  -LPp0@$ D0`XRlHHH H$$HHHHHHHHHHHHHHHHHH$HHHHHHHHHHHHHHHHHHHHHHHHHHH,4HhHHHHHHHHHHHHHHHHHHHHHHHHHHHH R* D0@D@ T1    R*0)S )( T 1H   R*0)S   R)@*0D?TS {T\)#00  W+T 3*T  R)@*0D?TS {T0S)t#00   h  f0 ~  f^  f 0r  fR?TF {T5 Rp*0,S( @ 0& R*0}S00 Q *0}S  R0 *0}S R*  00"00 L W@   f0   f  f6"  A-    f 0  f YQV  00  0 ((* 01  "   R*@ ]0  0( p, R*$ 00   -L@M R *R) . R: -L@p`PP\*0^S) \0` *S*0S +PP0SU0 S00C0 M (00000(00 @ ( P0,0( -L@`M P\U   J?0U .U *U Q* *RZ 0S*\R $U 0{S00 R`*0,S+ P 0Q*0S*0\S  Q *R*0R\S 0}S [ W0}S000S0*"00 \VP ; 0 h00   h  h 0  hV} y[U; JUu D0`D` V1    R *0S*0\S \) V 1H  u R*0S*0\S H0)S00C0)Sn; 01  $3 O/^?0U% >E0CS#<0pCaH0S  ; H  2 0H0_?0U 0R*0 0\ -@LP`p0S*  0#10T00S 0@BPT00U00S  l -L`pnP0SP:\&*0^S00p\*0]S -S \0* ]R S*-R P0]S-Ru \*0]S 30S 0 0@SJ0  d2  0H@TZ 0S?W"  0SJ 0 @@000l 0\0Z 0  00 0 B 0SP l hg h?P  00 0  00 -00-0 -  P}00 -00-0 -  k00 ]00]0 ] p kP & P0S8* < kP0 000hp -@PLP050#-S [S0 :Sa =S1  Rp*0-S `WW 0 00 \  R\*0]S -P0`0 `0S0%*00-S]S P*0S*0=S (0]S00P*0S0"*00-S]S 'P *0S*0:S 0]SP*0S05l:o h -LpM`@V*$Q0   P 0*0  @PPfi kP0S PP PP  000   PP0S  sk0SP -L@=M>0 00  0-L@ R%*0S*0[S 0 0.Q00QP*0S*0.S N00]S00D R* -L@   R'* P*0PS 0]S|pP`eV  rjP0 R 0S Hh0 00 L0 048C$0 048C p-L0K @M`00KP0]0K0K KmP`p -@L`P 08p@ h0  0 0S h 80S 400040 p-L0K K@MP` 0^00K]0 K 0K K-P`p -LP`@pM0ST1 T00W0 W00Si ` f 00   f  f"  A  i f0   f  f"  A   @`pG f 0  f  s@D m@D`q0S ᴻ -`L@ P0 0U 1R BdpP( d@0S 0S @P? >1(. 1E0 000 h j@ d\@@?>1" "\dp@-`0@ ^R *0 00  n^ :0E\  00C 0p -L` M,   S@0 "* 00T0R00S P*pP0 00 R0#S P: P @ T:`@ T*,,0`- 0R*0  R:@-0@P(0  \: -LP@`psi0 00R0Cc  0S00Chm 0  00Bc- 00/>\ 0S0\ 0@-@ 00>Q\  0R00\0 -L0S8p`0S PU`P 40PU040@0S  @TP -`RL@PpQ 0!1i000 p-L@`PM0Sp0\ 0  !p. p-L`PM\p@ A  0S0 0H0SHP Z  e! BDT 0Ap0S 1>3 01 0-@LP0S0 c0S @ 000h! 0-P@L00 b0S 00 000 0-PL@0S00># R. &R R @0Q@PR@P0 'bP<@0 @Q>3 SAQ000QNR RRN>3># R R "R(00(00R R0S0 0>3S S S\(00(0 P LR0@-P@0 0bRà B?Q0Q0 Q-L P@pJUp ONT`J5LW 1J,L O@pPpA -L@M4U0S _1PXx5 s10S,j1j5 q  -LP@ F\ x FPp`5p`F0S@`F5`ppC -LM8`p@P0 P@ Pp龻 0-L$K K, K(0K@K(M`K @4PP <0, [([$[ [[@[P @0鴒л -LDKp DM@P`0d!P@ P`LH8 P@ T`KM[P= T0C0 S R0T 0PK 0 T\ 0S PP0+SHKHbP 0 LKPKHzP0K LpPP LaLag00Ȓgܒ -LpMfD@P@ NoKZP< 81C0 S R08 J_K 0 8\ 50S,RPP0+SKKaP 0 KMK,PJ/K0PP 0`0`mig00gܒ 0-L$K K@P(0K0Mx, KKK@@ 3P , [([$[ [[0[ 00=g00@x 0-L@K M$$P$ g 00ֻ -L@S`PUMp4ȀK6A fCK\A fP *(K 0Q0#0A Q0 "P A:@KX@ g  cKCK@ Z V_OK< ^KJv` -L@ Ml hKflp `p 'h p0l@b b$  dP!͠ e eTPhPZP 傘x  ( y噐`P "  e eT PjPZd*P h yl `\P!p@=e eTPiPZt )P x y|pXP " e eT PfaPZ &P 傈y 噀TP !=e eTPgqPZ 'P 储 y@噠PP "p0͠ e eT PhPZ(P 傘 y@噐LP!͠ e eTPjPZd *P h yl` "HP  e  eTiPZt )PxP y|p DP !p@=e eTPfaPZP & y♀@P " e eT PgqPZP ' y♠002051? ?R@  dh_@@l  _?0S:@@?0S: 0-LP@KMP00  b!1P| 0~? S ` 0~? SK U0 1  b!1P0 4xB 024=> 0\@-d @4xB 02@- d@4=> 0~[@-0`Ƞ #1`(c4 ,4#@(`" @00-0   0 -=9?"`0L! M@P!K @ __00- 0BRSR 000SdEE@H`H|HHHIPI\Q 0 30%Q00S000 0AlS񟗗G,H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,H,HG,H,H,H,H,H,H,H,H,H,H,HGGGGGGGG,H,H,H,H,H,H,H,H,H,H,H,H,HG,H,H,H,H,H,H,HG,H,H,H,H,H,H,H,H,H,H,H,H,H,HG,HG,H,HGG,H,H,HG,H,H,H,H,H,H,HG,H,H,HHH H,H4Hed0 A0 `0 0 V0 0S00 0 0 0 0 0; 0-Q0 ^Q0100000&?Q00 000 00A0S0100C  00A0S0Е100C0  0D 0 0  000AW0C0000P 00 D  0 ,0  048C800AW0C 0 -L`0@pMPU(0  (K 0P$J JdJ$J@PU 0P@0j0@(K -L!@M [pKSP |pKvSP@t0Z U  0@P` d0 K0 0 K0 KP 0 PK8H($QL p-L`dMPPp @Tt 0R  HTxKP x0R t0RppQLp@-`0gSE -S S +S0pXS=6088S 0oS' uS=#S  @@0 30100  030100P80Q -L p0SV:`VP` T.0= :0` 0 uVX P a0AS"dOOOOOO|OOOOOOOOOOOOOOSP0>0P0 P C. P P00+Xp -X=XP0X =X <\ PX P0 0X0C S񟗘PXRXRXRXRXRXRXRXRXRXRXRXRXRXRPXRXRXRXRXRXRXRPXRXRxPPPPXRSSI_pI\ P\  [P R  P0\P@  D 00B 0-LP'>P@0 000, P  ,P  )P0PPs>0p>n> -L M0Sp$ D`@=PP  ZD0K8 K0 ,` 0P  @G>T t 8nPT -L M`0Sp@P) 2T@ !1T @@00C K0 nP P P >P>3T,@?P PКܚ 0-L@PM((( (0P@ P0P0xК -Lp`0S( 0#SP$ \Q@ 00  Q (QP% \Q 00  Q T0S 0dP3=P  C0 0 CP -L`PMP@ =寤pp K@!1 ~P@$Pg=$0(0 (pK,PK0@Kt 00Sв|$P=,P0 0 0 ? p-PLP`@M PU P V Ppy.P ps.P n.P -Lp`PM?P@  =T8p (K@!1 P,0@00 4K8PK,P<  0K  0\ +\\h,<4 P ,<808 @P0S 0S<T<8 <8 <8 j? -L@pPM:<P` T 0S8U 0S0 t -L M0@,S0T@\ @鼗 -PL`@pPM $BPT  B P@ K iPX<U  -RL@`pM9  PP Ap<@T T 0T,S 0S OP *<&< PU PP PPP p-LMP0 S0 `@0 P  P0S;0S0L H@0Sp 00p; ; ; -LPMPp`@ 0S\h0   P@0  h(X$0@-8@\ P 00P00  0 -L@P`Mp\0 U00T00S 300U0T00SVSPp  0`P@z 20 P  0$ -LMa0S<QQ/0!"b0cQ pP" 12c b!.  :0P @ /12c `t0p 0S00;@ /p /p -LpM`0S2PQࠟ% 0SȀP04<0t:0P @  t0p 0S00:@ p p p-LMH`@DPT8P R(00p P000s -L 0 s 0-L@KPM$0@8000 -0L@p M, ( :PPA 000$@$0,  { P 9P@? P6 0P500@ 4090 K SR/ P  $0#1 07 60  x巷p  㺷p強$00$0  ::: ?`0S , @T@0 $ 0 4`5`@470640#8S0607`,0S 00 S 0 , Y @@00u@00꼗T -L`@pM$0#8C$% $0$0#X +/_lP@ P @h?P +E4'0&P ,0 0 0S p-LP`MP $0240 @0S0@940  9PP{9$0 v9V0p)@0` P@`b9) -LpMPU $4  80#hV0@:0; O V4  "8S 0@TPn 79408Y 80#XU U 4 504$0% 4S % $04/00@$ "( r*@0 /R @470640#hV 0 :0; $0#14 ჶp   ᆶp 800C$9 80?000607 |?0 06 7$0#1P! P$0<$0z@8408s; $08#X4 ($0#1P 0S  B470@6 ^P 808#8 $0#1P P 3P?0 @-K?@$0Pt2 880@0C$T9 80 0  @T<$0004 "887CS "@470640#X $0#1p ᝵p   ᠵp 800C$9 80>000607p 喵> 07p 60@4706T RB4-L;0:  >00 @$04940#H T  T P0 U$0<$0PP4080 /R $0#1@ $  t,pp @ P, ( TB>0 0T -Lp4M$0 00, 4 0P< X0 _ , RX0L0 W $0Q O 420 0#00B L0 P L PRP D ,0S@@DH 4 48CȰ40$$8S  8#$0  /00 X 44 8@ C8  h0 T 8 <P` $0 0.S P P@u T UP0`*I$E45 %0$P40S80D0C$9 80Q L R 04 60 007060L0700 R8008@ 0@ @8@ L0S PQ P P $00@00 0607 $0@00 L@4Q7064 "(0B8RSAL $ 0"( @0X(PP $00@0 00X0 00hT0 Z=TP60d<>Q=P0 4607 $0<$0 0S^ 040. SdX<'@ RA$0 X 0AS`H R ,0ZS4408&$0 Z 0SZ00 0 ,Q4 0 607P $0<$0 406 74 1 j010 /R <0 40YP0H0   4 8040C$9 80D H <D <4000L0 P ,Q X4 060070<400 -L@`M$80|PK0p p-L#MK@D@DPMM>`p0 )0p!12c aP-LP`A! U.Pp  7#p W P ڋ`P@@TlPW. p # f # *H5* A5*A p-L@`P,M DKDPK<00<0 Q Q (500p  R2pQ  Z  V -@LP`I0 Tp !D:^! ,`0\0 ! 0,01 4`w -L$M@ < 20* dho1 k1.?0S: @@%?0S: p-L `K@P M 01?07S8 cx c4  sX 0p -L@@ DMhKl y 0 0h l00CULnLL̠ 0 0d 00餃J⊮J Jj 0 0` 00 ⁉Í臠  00\ 00C#IIIi 0 0X 00*C?LQL̠ 0 0T 00G⇨Ƭ*j 0 0P 00*a臠 L` 0000F╜i 0 0H 00iăŌ&ˌ̠ 0 0D 00C]J⻨Jj 0 0@ 00)COH臠  00< 00⣘I⡝IIi8 0 000kă ƌ̌"̠ 0 04 00CJ⛯JJj 0p 0 000঄yC⎀臠 ,P  0000Rmid  0 000ăȌ͌"͠ P  0 000ⳬ@ꫠ 0 0< 00yih 00h 00YCⓚI⅞IIi 0 0T 00ă/ȌA͌͠  0 0@ 00Qꫠ 0 0006⡈挈⁀h 00X 00: ICIIi 0 0D 00ŃɌΌ͠  0 000C⏪J₮J Jꫠ 0 0\ 00ಆC⯊H➏HHh 00H 00EZS-i 0 04 00ăȌ̌͠  0 0` 001CJJꫠ 0 000 HH'Hh 0000⩙2 iT 0) 0#00CkLLlΠ H  0,0#00q⁠ꪠ <  0* 0#00m❈a"h 0( 0#00CⱛII锠d 0) 0#00)ÃȌ̌DlΠ X  0,0#00!JJJꪠ 0* 0#00%CKHJHh @  0( 0#00࿔ICI␐I锠4 0) 0#00)ăLL:LlΠ h  0,0#00UC{JJJꪠ \  0* 0#005h P  0( 0#00⁚ 锠D 0) 0#00ă5nj ʌ9lΠ 0,0#00礃⑩J&JJꪠ 0* 0#00C]H⃌Hh `  0( 0#001+Ve锠 0h 00(00=Ã)Ȍ͌l͠ 000)00ըJiJj 000,00ૄ%⎍'舠 0T 00*00?ⓘ 9镠 000(00fă)LL=Ll͠ 0\ 00)003ɮj 0@ 00,00C.HH舠 0d 00*00!]ѐ镠 0H 00(00ƒWLLLl͠ 000)00CƫJJj 0P 00,00ࣄŏ舠 04 00*00N⁚镠 0X 00(00C2L_LLl͠ 0< 00)00ྤŨJ7J Jj 0` 00,00+ HⵍHH舠 0D 00*00QC9IⱝI/I  0镠  0 0hK @ - p-L@P`M,0 ,{T / 㻚 t| -L@Pp.`},T PbT  84 $0  Qt|ܵ --L%0r -LP@`M 0S0l 00 c 00P 0A0 0%s0 000'\00 V000  %00&" 00  00PPP00 7 V V4 V2  0F VS,, V           ( 8 H                   X 00  \00`P  R 0'\00M0`000 -0 ^0V0?0@00\00 "3000! 0  000\  00I0S0000Ĕ}\00a x\00b t\00t p\00n l\00v h\00f d\00r `\00s \5V00P0 @1  0 V V V  0F VS) V l l l l l l     ( 8 H l l l l l l l l l l l l l l l l l l X d0  0aP  R| z0'\00M0`00  0 cT -LpP M0S0l 00 c 00\ 0@0 0'0 000*\00 @T`,P  \T400 %00$20  @T`,0c000 P0 0 PP000 U T TR TP  0D TSJJ T?0T`l xXn000  00@S a0b0t0v0f0r000  @P  R  0##0  10000 0 t0*3M0@000 -00 ^00T?0@0s0@T`,P ^ \ T00P0 82  0\ T TY TW  0D TSQQ TEn00@T`0  00@S Ŕ a0b0t0v0f0r00  0 @P  R  0##0  10000 0 0*3M0@0<0  0 -00 ^00T?0@0s0T -L`Pp M 0S0l 00 c0 00P 0A0 0(0 000)\00 V,P  \@T000 %00$20  `V,0c004 P404 PP400 X T TU TS  0D TSMM TB4dp|$hn000 V 0/S7S Ŕa0b0t0v0f0r000  @P  R  0##0  10000 0 t0)3M0@000 -00 ^0T0?0@0s0V,P ] \@0mT00P0 82  0\ T TY TW  0D TSQQ TE                        n00`V0 V 0/S7S Ŕ a0b0t0v0f0r00  0 @P  R  0##0  10000 0 0)3M0@0<0  0 -00 ^0T0?0@0s0T -LP@`ğM 0S 0b 00 cğ 00Q 0 B0 0%s0 000'\00 V400  %00&"  00  00PPP00 7 V V4 V2  0F VS,, V (8HXh00  \00`P  R 0'\00M0`000 -0 ^0V0?0@00\00 "3000! 0  000\  00I0S0000Ĕ}\00a x\00b t\00t p\00n l\00v h\00f d\00r `\00s \V00P0 D1  0 V V V  0F VS) V ||||||(8HX||||||||||||||||||hh0  0aP  R| z0'\00M0`00  0 c꼗T 0-L0S0l 00 cd P 00@T 0L0 00 00"30#\000@0鼗 p-L@M0S0l 00 c`d00PU 0L0 00 00$30#\000P`p鼗 0- L!@TP0 0 !PPP 00 "@ 0-LP@!0CP \ 0 Q 01"P 0 00  P0-L@0 P0h!Q 0PU*!0PU5:! p-LP@`M0U *0P0p 0PU:p -L@PpMQ000$K 1$0T` 0S l0$0 W ` X\0$0T D(0"S `vV:(a$ 66T6 -LP@pMQ000$K 4$0U` 0S x0$0 W l0Xh $ `0჈(0"S 0V`"&$ v'6<6 -LRP,K`(PKM0 (0 (  , (020#pPl &PWx GldX0SPS 0PM 0@K0  0~P Z0 0\ W rP0  0@0 @bP (00  5 0$00 h1 0HU<Q,MP@ Z 0S AP W K0S PW ҇'#P 4@K 0P 40@0P  0P 40$067|.6 -P@LPp` P`5 PW Pp. X P@ 3'U 0S0``W |0 X `0 @@<'V0 Z ,  V ( 0-L'0@T @TPP h0@T @T<&080@T @T& ( -L@M0S00P0 0g -L@M0S00\\ p-L0MP`Q0- @ iPp 0#S/S  S  0#S/S SR#R`0  0 #Q Q 00pPp\X -L R 0p0 0-@PLP0S0P`` -L@0PKM` pA40r00 0SP@0 00 0@sPP RP00+ X@%@@U|T00%0S@ꌡ`X 0-@PLPP 0S 0 P P0P 0-@PLP0S0PSP0hh -L0 M`qQ00SI  `R(` P0` 5 (K,K 04@K0K @@T` T P(P 0PU00( ,0 0(@ 0 40p@+ 0/%@P0K< 0 4@K@P sPPhX p-LPD`M\%8@88@P,,, ,0廨phM%0LT p-LPK M>%00%` 0`P埨P@ 0 Rh 000 @'%Tp<0 R0 R0 @0 0p ġTL p-LPD`M%8@88@P,,, ,0gph$0LTPԡp@-P@T00\` 1Sp\V @00p - L CM M 00 L4 CnK`Fp0 LP4 CKH `F pG8KPH0<4 @4 @  ;`@@ @P,0P P@ ,01S P40LPH$00 - L MM 0  0 K0@L4 p !H PP7 㞾P0P 0@0S 0UL4 HH L:㉾KAP@A  /P0 P @:\\ :\@CP000S0$0S=KCK0CL0C LT4 X 4P 0P ,P @4KTDKX$;@@ @P80P yP@ 801S0< P004KW\ - L MM 0 0X4  0T }KpG`PpG0`F06?0W0/0000eQP 0.SQW 0w/SPtW/00 /P n.0080  P0-LP@ Q P000L@tP PP T0"S & p-PL@M:  1 0P+ 0 P`0S 00:S S00 p@Q 0 \Q00  :P P 0 0 0(PP0 @@@-@0P:P00P  P@^:T ^0@S ^:^ P 0^^ -0L KM0 -L`@!MM \8  < @8 Hh N R\VP P, > 0S0DH [P8  @ \L( * 0~KpG,X ` W*0 S- X\X :S# \S X(  S S0V:,(0b[@bP`P, ,<H8S 0 0@ˎX`X\ X( `FLX`0\0,0#SS ZP R ,yP ,0P8 P\D(0SD( P8S , T D= #Pv @0S :S@00D KN@j\ @ AD(@8FPp04 pJT8P0pT8 > @0S :S@0ic@0T:S:000f\(pbW,(0b0[`b b@bP , P` @ n  0`D,H8S0V@(:00dT H(R, J@H\,<(l0AU0T88(S T(6 P, ,@ )@ +P@ pH\T 0@( L8 &0,@H @@܍DBNK@D0P!L 0Pp D( ᶍP@ !0H8 ,#KA A8PP,@ ,`jP<88 `0 =PzD` P, 幧0,0`[DH  -L@p$`K,PKM$   0 p P , 0S00C$ 0 00 R- P  0S \L0:SS |S0:S|SS 0-L@P0h -LM<@0S00$0$ =00 -LM M0bS0S4 8 rP "0S0,@00 KAAU P@R ,8 0 C,\|  p2  0 P0 S\R000:Q #Q 0S 0R\S000 \PKI P0S :SJ \S 0SX?KAA P@pq ,80CP ZP*徾@@,8 S!(8[BNK@DS  :S|S 00SKA48(0A@O0S@HD0Py #P凾00P0@ T堶PT)0,啶PHg -Lp= P@  d3P` 0:SSd ^S \S $ @^ 0:SS00^f@A` P`x PfdP `d P00:P\00BS1P0C@ 0 0/S7SB0@@2S?dppppxpppppppppppppppppppppppppppppdppppxpppppppppppppppp00:00 0 0 00T 00S:S00ov 0 0y -Lp= !P@  d PP* 0:SSd   R0@ 0:SS00Re@AP PP  `edPd Py 0 0 0-LP# P0 0R @ 00B SaBQABW0B\70BS>. 0 XRxR @@0 :S0-LP 0:S0@0@0 -LM M0S0,4 04 > /㗮PTbTR4 LLH2`V`!B>K0C44 0S:SP 0S:SUppe 00Q S Ɋ Ŋ 0:S ,4S  000S0(0KBK@ @6/0D4D@ / @03DQ 4巊00CSsssssstsssstssssssssssss,u0,4 0S   1S!00 cd@440@  ~04S004 꼗^L"T( -L9`4 ' -SRL` P@ 8 0@,-  P@ 00 P  00%' e5*d2*(/*g,*)*A@-@^ 0 S SS00N p-LP@`M @p -LPM000#  1S018 p< @ @T8 o  010 0S 0 0 00Cp0>P %T 0S 0S0 0Cp 8(P 8Q43 @zT~l|~~~~~~~~~~~Ȋ8L\Ќ(4#,4# x 100Cs4C@4C @ @ <# 0S450# 0 0 00CS 0p Ÿ0 0T xЁ 4#Y  `@ T *000` dSP V( p 0i 0 ` 03 0῱P038C0@03 p8C 4Y # 0(@K RQ@ 0 0CY @0 S 0(K RQT pP T0(@K 03RQ0 @ 00C0Y00 0S0(K RQ@Z 008# 8# P Z43Y  0 0@0 0CY @0 S0 0 꿹P 0 00#@0C @00C0Y00 0S0 0 8 0dp08 08ꔹP ?4#I0Y!*+˯K4# m xh @+0DMSf긆ІІІІІІІ000000L000000L<3S4#)4# < 43 *;}44 @00CS0000lY4C6`_@ZXTxTV 4#40#/K 0bp`K MK<#@34 4@ 44 4 4 03 MK 03 88 4 03HC 03 @4 03H30CC$ @0C H#[ 43 03H[ @0C 030C H3@00C JKZZ᫸P 43 43  ;:<#0 48C8<3 43;<#0 48C8S<3 o< Q4#+4# ^h4 e !60/K00Z^0<3 N?0IY!43:;˯K43 N @+0D:SH  8PP4 4 @00CS0000IY4#   8@zeTET/g440#OK 0dKa435.K 03@ 0C @08# 8# 4# 035NK 03 03@00 7@z?KZzOK.ZϷP 4# +4# 43 ; 43 4 : S9 ;긷PC ᳷P) 43043 4# 4# 1@3 @< JK43;@43 4CK4C @ @hP4C@ 44 i4C g0@@3 4#@ lP43 0 4C@4C  03G$003  p 4,4C 03 0 p4#4C4C 4C 03 0 4# 03 03 p4C@03@ 0C  03/003 4#+@0@ 4# <3 4@4# !@# @ 044  @A@C @00 44 h!43PH@p0S 40 kP pF  p-L`PM PH@p0S 40 P p(0 0  -LMD @T< 00P 0  0@ -L& P P   0 (P =P  p-LP@M `P L噛T 8 L,0, C# ph釛t|ܵ -L 0KKM 0  -LM0 , 1,P@ 010-T@4  40 +T@XX0T_ X0T ɯ 0 o 0 p`^8 80000@D, 70DW0D@T&\R QQ0 8T00S "0 0@ 0 j5 /R0040\00S q 00S \,00E0XSxS@P -L$M@ < 2K@ @0C DD @ h @@DKCKPPg B~Kd3pG pG@0F>Kp0C0C@<#P@ tZ3x \x  0 d l$x (0F @H@I@J@K@L@M@U@F GN@O@P@Q@R@S@T@ 04CIH00$[.4[$4(!"(A4BJK0ML 0 4CWV00d0A l8HdtZ BNKl@D!1 }ppK pA:0#S=EKLK A 0 L AHH4 T P L 2P4H$0P }dF0PHPIPJUP F0GJPKPLPMPNPOPPPQPRPSPTP0 4CH0INH B4W0V ||t4SdPV0꬧tħԧ&h%|,8 -L@M\ 0 0X \0 -L@Ma0ShJ -LPTPhp@T` JP `@T\ 0V0000ht P0-0L@@P 000S P00\P 0 t p-LPMP`P@TK U`,P@@pP t -PL@ M 0SV0@S/ P  C* 0-PL@P MM@0S`Y W Y000v  SPp 0S(X\ ($0K K0 8P    lP K80[,[K, 0KKTP\T_QH &pP 8K&_4X -LP4K`pMq&P\  4K$ P4K$P00UX`H`dP@6 ` <m[Pp- V!1PP" 0{,`K 0ⰁH0PTp K8PP ,8P 50 004,PR<@v_T W?= j_,|P -LPᨠKpKMT` P0 p7p@0S T3<0 S*S6 @<@  0[S" 000 MP 1 S   K0K}P  0[@@ @@ -L@p MT`P0  '0S0@P<@P0 @'P1S -0LT -L0@MT0 0-@LTPpu 00SP|z@P 4P$P0hnmki -L@Md?`0SXT P0P 0 H0H 0 @0@ 0 800 h&T l <xd4 -L@TaV! \^ PUr * @ `P    P   QPD.^($^"^t4( -L`MTpQ 0ATP T0! 1Q@ Q 0$Q$9 Q0S$001 P0 00P*00800  0 0<< @T0!b 1  $0 AA V him``](eP@ _P(]ttج -LpMT`, 封CT0!P!0AT. 0S $@TP00  )0S 0R 0R<0Q @yP 0,0 t -Lon@K,M10D a0* `p`PP@ *K)KP` <0K D< *K4 0 8 @PP,0#8 0,0 00Y]00U]00R]0<\2h1D -PL@M 0Sh0t  -Lp$Mxb\<0 8 h2P@Tp U 0S@R0SR0`S`H 08\]00 K00 ,` 04 K0P$ p8+P00 00 0<0  PP8!E04 r00S 0S0S8PEP MP@ 0Sp0000\0\ 00\@00((0@hdNp @t $ -Lp4M(P$U`@- 0 0 T L Hp P )XK%P 000S` -, 0 (2d\dPP DP ,P P  <L,  -LLM8ŸP4l `p t0 U 0@ @XpKLK00000 ` 0 RhKe l0h0 0P] 0 0StS p00SL 0 00 10<0 080 c$0SdK( $d@T 0  PT  0H0P@@S 00# 0P@ @P@/$P  <0u -Lp`H0@DT8P ,00 < -LMP@P0S@ <0< 0 404 0 ,0, 0 x X\ -L`P$M08  SP@  < P`<0  `0Pp$ P'04K00KR01 5Z1Z 0<0 `0Pp08004K[p[4K000P. -Lp` M PP6 Z`4@K \0 " .P` Z0S ZZZ0S   Y ZZ40KZ0SZ00Z0 0 p-SLP`0M  $ P S K P@  P$ 0 PPBP   p0 P  0$ 0 PP$P 0S 0S K0$ K0 P PIZ0 0 -pLP`pM< h 8K P 0"p@Z 08 RQTD T %Z 00"Z@_00Y 7p  0nPV@T V10 0 崙 屙Y 0   "P<0K   0@Y 00Y0 0 Q | pP 8K@" P  꼗 -L`tM  xK h K0 l x t p 匠 pD @#0ScQ@ #P   좟P VP @TPhK 0S KP@  KF KAP00X@@TpkPZ 0 pjP`P   0  00 P0p@Ā[0L0  0H0 0X %XK!P 0Fg: K .A 0 @ 0@ @ Y00Y@Y VXX 00X@400X00X00X00X@X00,0a `AhK     -LM0 00 0  K K0 0 `00 !R 0>(0 !Rp8`8 T 0s  0K0K p000 000K 0 P 0 0P KP 00 0  0 Y0P R0S (7L0KА< 8 2l  K0K p P 0C8 SP l0S@ 0@@z0P^0S Z0#S V040},6 0AwK :00P0 Rp@K 0XPK$} PD P0S@0S0  0S# S Q  0 P00C0 D 95 0@A2K 00p LK 0P0 0 H0S 00LK00x00 000LH0 8K $00<0= Xp=H HXpRʴK0= 0 S0 ڴ000  =)B -BR W0XPL0 <K (00000 Sv 0S } R K:p r00 0@K/pX 0 a0cXpH=9?0X=H HXp0 W0K 'X#H0S@Kp m<00@b1 0A\K 00 0tNp0 `HK  L!0= XpG 00@0 + 0$ K00@0 AK 00S0TXT0 0@A<K ,00>0?K0   dN0u00 -L8K0HK$MP @<0 pH0 D0 @0 0 !R` `0l 1S00 @0  y00    -L8K0@pHK$M` S<0 H0 D0 @0 \0 !R㐣 0t0 !R`3 L |T8 T W 0DS)888Dht;P0X0 @AR  00lE0 @AT?  00~0 OP0000 000 b"b$!$" 00Cc( #c4("4#00 0c( #(c4"4#00 0c( #(c4"4# 0 R 000 q  00@@0 A  00 PP@D0 4A  y00   dN -L08 KHK$M`qP<0 H0 D0 @0 ]0!R쐟 ܐ@0!R0S&00S P 0SP 0S Tj8K -0|z k    0-L$PK04K  Mt@(0 40 00 ,0 `B0SP L0L 0 D0D 0 <0< 0 1 0 t04 0S =9p =P  -L`HK@P(MRPpD KL0K8@ KK0CP  C K*K`@ (, DH P<T@zKP$ zKEKK(N(A(0N*K0`AZK`2dbhzK$PP pWK,\GmK(`F`FRGPH Kh(K(K@ /L KJD(Kd:K0@D!0@CIP K( K x:KPLK(K0CMJ@D0C-J PZK00*K(0KL" rLR PK0(K`P 0(KT:KRUP1R0S *K,"0*K,2:Kh2P:KhRZKdR`ZKdbjK`bpjK`r0SKH oKD KDPK@rKLki  K*KD"RZK,RpW*ZKCm(PE`F0PE@(K 0TiK,p W@P:K  0*K$B:KK,Y: KQ*K"RP:KRjK&zKK!KP00\ppW J F]K(PE:KPRjKE0P$`0 B)p  KFA2(K0a *((`KKjK h  K\ *Kd X@Klp LK0b `jKPb"   jK bK@K "W@KpK P @K P KzKrW0Y_ ,\<0@K<00KS0*K@"Rk`@ZK V4bK,pW*C]K(PEPE(K K00S 3K2"5*:K,2pW᠀P:PU K" E}K(pG(GKX K*K:KX,4"p P`ZKb:K42`PU:K4RڦKp,W00 W0#02KS8r  K\rCKE]K(J(PEJ(PE 048 KC8T" K8K,*K\"P00pW0#02S0*KP\2堠  :K82`:K8b00K8K8 CmK(`F`FK\:K @0@\*P@ ?0S QjKPK0 R{ K@Q KD0R44FK(N(4dK8NPT P0 K 0@Kp@KpK`P0 h0S-X0S* K@P00S? G-K( B BK0\8@@#8c4#888#8C$ GK0(LG=L0C(PK  zK@`T #0pK@K@0 P &@K `<00SzKTrWK  @KK( d@ 0ZKTh2dK KP\2P0 PT :/0C@T 8 7jK\0" 0 ` *K@"R :KKPD<"0 @T@CK<P  K"P@5K0 PKppFM:KGKH"P0p zKK(ND7PErN(KP` '@D\P FKd (HpzKK`r (HZKp8`F@KR p Pp@KpK PD @K~ P? <0@K:K<<00SP @KL@KDK\K꼭ȭ0u1P.) $ -L MPP PΠ } -LQPpM@V TM TF0 )`0 @0[0 04K0K  崀 P@0K  P@  0$@  T` 0KU  K(P`  0Kq.0 00`0 @ PK K00 (p  @[ -LpsM (P`@ Pp: $$1P@ 0 Pz_K$pK@@,@ 0K8 .< 4 0 , @KP& 100sP K @OVW Pxu,0uP -LnK~KRMEp 0 0KP@P0 p  -L$0!00  -LK0C/KpM␡X0 ?KL ,0 0ApT tK0P" \0K80KhD`KD (@ d0` @0 < ) P;1\ D@P0S" \Pj0!T0P P 0\uc0S R 1Q!,u -pWLP`dA 0C8 Lp H0  0 $ ?W`kuP P(0  Q0 u 0-LP@B0S 0B0S ID0S  BD0S ;DP -LP@$K M0S``00S0$0 PC\H0  $\ VpAP V0(@K@(p L% 0- LP@D0S  0C0S XB0S  C0S CP -LP@$K M0S``00S0$0 B\H0  $\ VpCAP V0(@K@(p & -L` P0P@C 0c( #(c4"4#0@0c( #(c4"4#0 b80"8b$#$" 0 @pAP 0P 00h 00nAP  0APAP AP 0- L@PKC0S 0CA0S   0-L@PAP 0 00hB -Lp`M@T 0S,Q0!#(0PPn 0 cb#"Pc4b$!4# $"\0P 0c( #(c4"4#00S 0c( #(c4"4#0P0c( #(c4"4#0P0c( #(c4"4#0P0c( #(c4"4#0P0c( #(c4"4#0 R$0c( #(c4"4#0$P0c( #(c4"4#0 R|000P@T. @PAP 0S@P 0S @P @P @P P $i0 PP 0c( #(c4"4#0`80 8`# Pa0c( #(c4"4#S00c( #(c4"4# 00c( #(c4"4#0 b80"8b$#$" 0c( #(c4"4#0a80!8a#!Q Q0SP 0PPG 0PP$0 0c( #(c4"4#$0 b80"8b$#$" QI Q0SMP 0PP 2DAP+AP ,?P2AP -L `LM\0 pT X o` TKa*00P0PP @0K X@ < \8 0 , P H LD PK@0` `00001 -L@P?P?P ?P 0 `p?P 0P 00h 00v?P  0 0-L@ PM0K0!H0>0S0Y?0S 00 0/ 0-LP@H?0S0@?0S :?0S  0h3? -RRLP@p$M"0R `@K%4V0x   ߚ P0U ^@TPT -Lp`PMd @T  P8 @ T PT -LM  ! 1 P `P` 0xKh K㌣l0 x0 t0 p0 x@T h3 R 0KC/K 1 Pf4BK P/ hK E?KPP PPtP 1 00Hp0sP @,0L  X@ TP H XK P 0SVY NZL0L00SDA BK BKA@0F F09S D 00D@=0l0d! JPLH!H1@sQpNP  $0S?P TPXPSPU@OK@,hK |x |0 tmCC 00C@00sHbCC 00C@00k  $DC8Hd -LtM  xK h K0 0l x t 0 p 0 !R $0 0 !R44  , H`0S 0S   00C0pc8 0' 8 gt#t'D  P |K| 0P 0 0P KP "P@ R 0S@T 00LKxS0<0 XK`#8 @T e P@ 0S o 3 0AihK ,00 X0S  0S 00Cs0   0 PlFh2 0@AP?hK @00}   0P0  0$ H0S 00 0P 0S0 00 A  hKl!0TP1 0@AhK ,0080 00 0hK  00!0 0AhK 00 0 0S0 0@GH 0S0S P 0  $dN0uP.0 0 -L8K0HK$MP @<0 HpH0 D0 @0 S0 !R` `0l 1S00 @0o  200  $ -L8K0@pHK$M` XS<0 H0 D0 @0 DL0 !R0 (0l0 !R3  5T؂ T Wv 0DS+?@@\@\@@@\@\@@A(A0APAXA\@|P0  P0 @A8  00H0 @A  0050 000,0c( #(c4"4#00c( #(c4"4#,0<00c( #(c4"4#<0800c( #(c4"4#800 q  s00@@0 A  _00PP@D0 4A  J00  $dN -L08 KHK$MPp`<0 H0 D0 @0 .e0!R ᰠ@0!R0S pWL00SPa _@A8K 0SH  $ -L`M@ 2dA'AVP 0 ,0 0(0K,pK' K p@ 0S 0 00$0P0 0  Vp` P0` 06  $ 0 0 -RLp`PM  pVp@P`` U 0 0$  0-L$PK04K  Mt@(0 40 00 ,0 `0SP L0L 0 D0D 0 <0< 0  l0P8>==tB>_6 ^:<R =9p =P  p-L@MP@T% < 0R P0`K( p x  <9,0,00 S< XP@p (0u -L000( S < 0 ( 0-LPK 0K`@M\  0  PPP 0S H 0-RL@@@PP8 M0@ 0$P @fq뼗-İ|0 -LPpAMMa|( U@ @1B^KPE 0!E @p0  _ bl10E0 ll)q00\0PP 0S A0C+S.\JDJDJDJhJDJDJDJDJDJDJtJDJDJDJDJDJDJDJDJDJDJDJDJDJDJDJDJDJDJDJDJ8JDJDJDJJDJDJDJDJDJDJJ000 0S0000000000CL-< 3|(0 ki.*+*` `       -L M(@0SP h, -LP`M0`,0 "@T9 P80S0, `<0 SpH$0 0 0X @(pL `  ,p0DP@T,00040;>o 4>o1>\8 -L@ KM 00S(,00nS 0c( #(c4"4#0(000C000)0P 0c( #(c4"4#0 0-LP @  0S 00c( #(c4"4#000 0P0 0 0 -RL`p P 0@T 40SP VT@! Pp`d 000d00 -RL`p P0@DT@! 0 0S 0`dp V00qP 0- LP0 @p 0S S 0, 0CP0 0C0q0 p-L@PM `pd R * 0 `Q0Q3 5p9p0(0 P`,0Q$0Q 0` 00%!(%p)-0S  $ 0Q 00Q(a,0Q (0 -LM @$h -LM @@ R!0Q|0S 4 0R00 00S40S 040GP40S K ZP000( R P0 -LM @0QA0S 4 0R00 00S40S , (0S P40S @-0S 0S 00@ 0@T*0 c B!b"b$!$" @ -L`p @DPU.P L bP1 ࠱P3P L0 R0L0ࠑP 0(H0c( #(c4"4#H0? \ Q<T0Q8<0QT7H0S1ó H04 X0$T  cP$W000T PX 0040SH0L0DP $0 T, (00X0 0Q<@\ 0-LQP 0b@Ca80!8a#! @a P0 0 0 0 p-L@M@`Vp,0$P0 P cp (PP,Pp -LPp`@0S , 0CR((00(0R ,0@DT(P VT@! (00(0p`d 0-LPK M@@T 0P 0c( #(c4"4#!40 0  p-QL`PM ,0@DT(0 T@!0(0`dVpyPpcP 0-L@P<0Q00${P0 $0( 0c P,( $

0 0h\3 &3 0-LP@P0 2P0 0S010S; 0 4c4#888#8WSpG)BKIIˠ 0 G0PS P R*I@'IH 0$H(0"( PgP0pG S010S -L`VMM PH `5 L%   R `1   7ܻL%H6f0 L5!  S <0!X% T5 \ Q pm 0118# QpP@qq@؁P0SÌ Z@410 E 80#A Q 0U0Ch5 3SKIIhu.p Z@pl U h% Z 11p1!4C1@QQUhu†pPNDl%A!p510pWdu  Zd% Rd% rX5S \5S=00 <0T5 !D 10 2t 1\! MK@DS^KpPE PE@DpG p `5 P}갔<t|)Xv R 0X5SoUKNKUNK L@D LHL%@D`5@QPWH X5S P `1     2غ `1  0P%R `2Y/ X5S 10#"40# \$ }KPpG@pG`5@pDHL% Pt<`t| 0Zf0K)TU P%UQKpL LpHL%`5d ~PBNK@D@D; Dt 0PKPk 0<D]eRKh5AA hfRK@@ _Q\ @0J^KPESPE@ 1S.K Bs B ZW{ u0@5 0S !PpP 00 0$$40SS2 Q 1S -L`M     P" 11P10# 2 dPP1S@@"P101:@K  PKF Z8pK  dPK  0K o0P0 @:0K9 K< "()APP@<0#8eC$Ȱ9 K:0KUF xWG490K:pK0p @B4B 90K: K< " Q@Y"( @PP@<0#8eC$9 K:0K< $00 0#U"R @0dC$9 K:0K<0 #8   OK S 1,#@PP<0#8`C$9 K:0K<0#8S0 8S 0`1   $2$* W 2-v0(00 b\ 100!0U00B 0$6R@@T  # 0000!000!+P .0@S0 j@000 u&00@K0-.K2 PPq 01|\$hдܴ -LAM 1 q  ! @}`s1sPG 011 0 ![ P 40%  0Xx Tp@KWp`K   0K00pK A  @P$A P .K`H` (0KD` K@` <` 8` 4` 0` ,` qA$q nj 0  P@KK0 ,K@0HK |Kp@P 0S@K L0L$ \ 7@AKpK 0 @P` P!A0 8S 0`1  3  V 3k, b q0QI  CK!@0 rP 0`1  3 q00SS S 0 0@@ 2墷 `P  `2l呷 V @2, 101 " 2 } V 1, pP0`1 P 1 0(00O Z`0!C000` 01F@K  MP4P P0  0(0 `P1+P .0@SX0 _00,0` T -&00|x1$0Hl -L@BnKCMM`F}KP`FpG;0 pGPP  @p0SP+ X 0 ,ZrX ,@KmX-DKĵ -L@Pp`a0 @Z@X 0Y p-L`M 0RpR R p0 #8"Sp }Pp 0$4Rp@P0  4$8Qp -LPPKp@K,M`V@P  @0K T8 K= 0 P=TP8K =VHK P0K @0K  * **E-`@P M\(p \  Ѝ(p,0 ЍE\(p,0 ЍEQ -LPPAMM,$  p 0S(ß0@S  2S  2S"0Q0$ 0 0 ZYd4  2P@  P & X@0Sk SI ,$XR ' #04P BNK@D4 ?PPg@`$Pa @ 0S6?0@8#8L4 @?08#? X@Qd Z@: P4S0CP4 XQ00T0#02ST$R p0D$SH4@@@ 0  T58@CKAA (%m @4P cUUљ @4 0@$ WWL$R L WQ LQ 0ASdD*@)PL)0t% *HL$ RW SR (4@姯PD4 UL$R- T4S @4 0b3 RX%"@ X %*3H$R*H4  H4 dD@40@4 XQT$ T$ k@4`0@40@4 CK@@ <4S84S44s@4 %GL4S@\SP@4% @ 0l M>PP@g>P d4@TTQ@4P"0 l2DQ@4504P#D 5u @\PUX$ X$ 2 BKJJˠ 0>PP >P d4@T 8@4P cUUX$ X$   @4\4 0@4 \1DQ*BKJJˠ 0=PP `$P d@T@4D$0D$ PUX40X4 @4 0@4 P@ `UUѼ @$0@4 L0 @PU@4( @$ 0KW4` վxll38Py<h p-L`MP@p 0   "PU p Pp p-L@PM` V@ @p -QLp`M Q0. 0p\P R00  @Ta 00 .T 0 0 DM:Q (0P00P _Ÿ@ 0K"2`@ pEPP0 ܡ@T 00 D:T .T 0P.S Q ^P+ 0Shh+@14 , @@PD@ 1  :\P0P.S 萟 3PP+ SD;0,0 P 0 0@@`0T@*D,K>.P`d(0 /000RPyl (ll38 p-RQLM0SA RQ0S^0s ^ S P P  R% R0SPK`@P  @ 0/EPPp00 <0 /0000SS Pyl 8 0-@L0P0S((b0@0algp 0-L$PP0 0@T0Yj@0lp -LH0S<<mbP  $:P@} 0#S aPP ``aPP `a NPpKڴ0S S 0S S1 ` 0 p0 S S0 S S T1<P`0caPP 00U 0S  R00 R@@TP U 0S 0 0VP4=aPP @ PP@ 0 pp ,0 lglDl38Pyh -L@M0 P0  Py -L@pMl2 ;P`[ "WY0S MP P R  DP  R R W(l 0P1 1cR@,<P! @00 RP R 00 R0S 00 @0 叿 0p@1 4 R@W = j=0R( p@ f@0S0SP @0S0SpG 0w0@XP 0pGw@@00( B00pPyo8 -L M|0Pt0pP p`fP@  0S0cvPmT0 @ pPy 0-LPK @M 00S Z00 00 p-L@`M0Sp 0SpP0 S0 0p 00c0 bR00p 000 Rp 0 00+ -L M0Sp6 SP*IP0 @  P` Ƞ 0P0 `PᚸUP@00S S ᇸPPy -L0 AMMZ0 pt ZBKHHP+`K@e0 , !u0PP[SY*@TZ+ =;0PNPPI 4P`> Ƞ 0 P@7 0`@8T Q  6!0Z0P "04@ 0 0   0 0 00S S`0   0 BKHH   muꧺHPl38Py\ -0LQ`pd M0X20 Q0 0<24"0, "Y$^P@P VPt Vk 00S T 0S S @ 0SP , 000VN VE 0 S S0 S S d^Pp@ 0 0 RPPp%UpT 0S  R00 RPPU@ T 0S  R 0Z@4^P@ PṨP 0Zp4x0 2, 0, `0 1P  "10 8 a0n8ht -L@M؀0S`@gP+ TpK .07P# PP0V |@ @ӼXK0 nP L0  !P0xPy -L`M0SpP# 0S0X @ @0(K 7P X0  P̶P4Py p-L@P` K M w P 0K`  p@-0@M-013e8C06 -L`@PpM60e@@ S)@)p5 @4pp y@440@#8c4#8888#(b$"((("(B4 0f |zĸԸ - LQpUM M|% % c 0]RNK@D ,Wd100d1 0! 5 `ȑ帑弑x5 0Бё'5K%%K$ &KP /:ɟ1? (1?d10d1x%ٳP= `` I_PD`H@ x`0| S \T!* R R00 R0SZP\ T: P P P P 0S S S S000X Pt x%  BK@t%Ps (4[;S #S BK@ 㷵P""4[ S S|5SBKAP R R R00R``V`@ H_aXP`BK@ ㍵PU"4[ S SQ|%R S SB>K0CP \ \ \00\@@T`` vH_A QP@PD`H@`0S \ T!*  \00 \PZP\ T: P P P 0S S S000lBKp@ 0PX4[ S STxQQB.K B S S P0 S S )0 S SK S>K0C 0CVNK@D5 @ H D HV>K0C-K0C BkP@+p5 R'P Rx2@Åp)x% x% x54x5/p5BK@ дPn 4[ S Sj5 SB^K \ \ \ \ 0 SS ;S 0 S $QP  ;Q X3  0 VnK`F0`F0 P5 Sl5Ah1 PP! R;R  00 P 00 Pl5 l1 % % @hlhlBK0@ ZP!4[ S SB.K B!x5S 0 d102d1tO_`0SA Y#`0` SD `HDH@P 0.\`SPTP *V.`FڔPPPT:0  $PP!G000%DQ @ H0SBNK@D P.ePP ` G0  0 N@4A0@P(g  (4$<HLt| -L`p@0䁐0S S S0 S S  㰳P%uPd1d1 0 0d1Pd!0dh0 R R R 0 R R R0SH ㄳP IP0P00 rP  7P00P0  _P 0 lsd G000H KP060$ AP  ;P0:  3P09  +P09  #P01  P02  PXr @d>P?P F 02c, P PXV @>P?P E 0(3GP ۲P< @ ԲP01 | ̲P-01\WGꈹȹع p08HPX`lx-̠M 048PP U 0S S SPU 0S00 0CX Q|>PP  P@k0Pef0P꩗ ?P0꤁g 0-L@P, (0T ]  0h t| RAQ:0S A Q:0S -LSpM< 4 4ß 00 0@0 ֏8 W00< 0,K0PP. ,\X 0P@ *0S @ 0T: \R 0 S RL, @0\S 0R@S@Bx 0Y0\``VV < R0Տ00Z00SB Y@ 08P; 0S @ P1 0S , S  0S $ SQ  R R0@ R0  R0 R @0R R P@  0S00 ኜ8 4Q8  80  P@ 8,  Ĝ8,08 `0m Ზ 'P,,0 C< , yP,^eY00\00<0 , X 0-@LPH0S0)DǖP0HPD00 -LPp0SH  P@ 0@`c`@   fA4 0 `PP j#D ^xFPP@ 0@pc`P D  E00g0@D`000`RFP000 -LP`MM@ `0D4 00PXl"奕PpG  @ @CKJJH  0,PlD$0R0X00S @`1 XVF V4 !  0 P O mꐜ0Sҕ`0S;0]Pp 0 ,‹y- /W ᶕ<0#8)S80K8 Ƞ2 [#8,Ƞ .< B@8 c<4[ S 0HNx .E0S Ah-LD4SX@`1   T(8 -LXPK lM `>P*HK@ @HK @l  @LKP`AP0 (8"(,Ƞ!.Tp#\ ` d h  50P0S 0l!u.`AT   ;X`AT  e  0 @ P  @ @P p pP  @ @P  @ @P  @ @vPt  @ @jPb  @ @^PP`AT   ll\0 -ld`0 -l\d0 -lT h0-`AT   0`\ 0`V @0`P 0`J\dK0h0  0b 0\ 0V 0Pr 0J` 0DNt 0><` 08*,@ {-L| -LA^K PE` MMPEK@p  0@P@ 4[S.9p0, -LP  Mp@pz`V0P 0 0S.S R0 0T p-LANK@D@DˠPM M0 P`0 10p p-L@P`M0SV00p-P @0SV00p -L@M\ 0Q 0S ,,+,T00T0 03PQ -L@M0S 0Q 0S ,, ,T00T003PQ -L@ KM<0S0T$0 :+0T30 Q  L -L@ KM<0S0T$0 :+03  P-L( &P P P +P P@P  PP  PP  P  P P  PPt PhP\ PTع3 ( 0<HpPTH\ -L( @M$P I+4  Mp-LH`K4M .0\ P@ H`K <++T Dp;* 000Bh p-L@  @M@ P<@0!d@dP,`0 *p<4p -Lp`@MP耟0   0 0@A.^ 11a@ 0V :@T P P 0  0 ! nB00`CPG-`pM4@ 0   0 0pAP40  0 $40 A @ P 0! 0`B @3 0  0 30 # @ P 0! 0B @.\ X30 0  ,30  0 E0N2S񟗓cddddddddcddddddddddddddddddddddcddddddddcddddddddd2g12c1"c11E0N2SPddddddddddddddddddddddddddddddddddddddddddddddddddd00 10 0  00  00 0Ѝ002g12c1"c110c0jp00 = @0!!!KB3 P0! B00C' -L(PKp$M8 , 0 4 勖05 0K`4K@4K0S0@0 0D L H0  R R Q< ,0-S , @ 0+S, C00  P, !0P0 0pA0.S 11@1pC00 &▌  \ *, 0Q0 \:C00 : \ *, 0Q0 . \:800)L))T<08 #̠L00(|(hD  <0#(#H000 0 (<@ P0p`0r\*A,00 L \ *, 0Q0 \:A00  \*, 0Q0  \:\*4A,00 D \ *, 0Q0 \:00  \|*, 0Q0  \:o\m*nH h, 0 / , 10C0 , 00C!Q<@  -LtM, Q 2R0 P  T `0P@8 <4(,&7$< 0 ^&Gn&GN00,0LLD0@@DH H YiS L0 N0@ @0 2< H<+<8 A<$<4 :ZjEWD D  ,<<` %<<` ddP@LW6pPS6X TO68 \ W 0 `$@(P<@` DH  00X ,0R0 x00\00P`0040T4'WXQ\ R0'H4 | -L@M▔Q 0 .SR0*S P0 S.RQA -L0KM#" 0 v.0  0@ L'4 -L@ KpM 0SP  9P` 00 W 0 0=$K` OP60S$ U0#03Q00S0 0  -L@ KpM 0SP  P` 00 W 0 0$K` P0S$ U0#03Q00S0 0 TP -Lp M0 , p,P@ 010-T0@40  40 +T@WW0T@ W0T ppψ` 0000@D 70DW0D@TRV00 T00SF&  `"0 0@40R00S00`fS R,00E0XSxS@pP p-@LPM:0 CR 0P `0lp0R \]'` -LM0 CR @000R@ TC' 0-LPM( > (0K $ 0   00 K 1S01@'0 p-@LPM݅0 CR 0P `0p0R \'` 0-L0S 00 S0P0pPS000S0001 =0@ A04 y@0:@4A0@Pw$  -L@P`4p00# 0hpPw -L`pPMp, @t  P 0 P Pw -L`pPMP, @t   0 Pw0Pw0PwPw -L@P`pM@, Tp0 0 p0PwPw -L`pPMP, 6@t   0;Pw -L`pPMX, @t  @ 0@LPw 0-L@P M 0PJ0Pw; 0}Pw40Py -L$M`K@ L T\V$Hdt. @X%X @0 P@T -LKpzMM  KK::K\  ` PR ]0S@3 PL 0; PK   P0*KP: K @g댠K0  b$@  0 PK  0( PK೐ 0FS7~ЖЖ|ЖЖЖЖȉȉHȉP$X(ēЖKQ   0 LʟK*Q<:<0 n7#@ 0 P0*K:h 0 S_* %# `nV`XP@ #PU@ @j 0 P0*K:EVp  0PK 90  0P K- "PU@ɟ 0 @00 .PU 0j P0*K: 00 S 0:K0nK K  ԏ V K 0` K*K:K @   0PP K 0DYP0*K:KK   0PP K 0@P0*K: 0nS7 0@< 0 +PK   g"@  0P K 0-PK೐    0P K* 0@d 0 P:Kp P@K೐ f  0PK೐ V   0P K*L 0@ 0 P:K;| P@K೐ 1  0PK೐ !  0P K* Q 0@ 0 P:KG P@K೐  Y 0PK೐   0 0fP K*  0@ 0 UP:K P@K೐  $  0>P K* 0OPK೐  8 0'P K**K*R 0  U r  0  Q!@ 0  P:K 0` ^0 p'*P 0P Wd 0P0*K p:hd (!@  0PKpG X` 0 S: 0PK  PN*  0@TK 0 7  ^ : ^:6P K' *K:K @   0P#P K 0P0*K: KK   0P P KW 0 P0*K@: 0 kDLT@pPX\`xht,@!(@8 0 P0*K@:: 0H 0 2PK V   0gP@ K ^:K:S 0 ("( Q @  0PK K*K  uKOK   M  0K\ 0 @H` $H 0P 0 $ P @  0PK A}X w 0 P @ 0P K*( b 0 ~ @ 0  P:K H 0 ("(, @  0PK K*K  0PP KZ|K (pG,pG= ` 00P@c.T^PU T 0TPK +ᩌ  0HQeK 00P 0\0 9P KU 0,P0*K:dKQ!   (0 "(  T@ 0  P0*K:}K (pG1 1ER#PU  @ 0 IP0*K:*K*R?  0` N^KhPE 0@ H$H PE 0&h Ƞ,Ƞ0  c@ 0 P:KK*K K\  0@ K^KHPE 0$HPE8#8 x 7@ 0PK h  0$P K@*] 0  0 P:KO  0 P@K೐ D 0 4  0 P K*6 0  P:K@+ 0  0 PK  R 0@ z\KH(PEI  0$HTPE8#8 4 @ 0{P0*K: @ Pd0 S Ȋ  0 z,K( B, BP@^Pk*PUT 0 s᫊  0Jz KQ(@e,@K 00P 0\0 8P KU  0+P KlK\ 0 `@  0PK  0`V VQ $0 S*z00 D7 8 0PT U1*/QX ]QD \2 00 % < R& @T U15: UT1( #*P00 S 0`0c340A  P 80P00@ 0Q<@ 00 D x0  YrXp \ <0S  ,K ,0 ]RX20@_0 R0@RAS0S<01 -L` M0 , ,P@ 010-T@ +T@VV0TU V0T ``Zqqs-sZp Xfph 0000@D+ 70DW0D@T%QZ R00T00S d ~!"00@R00T00SB" ~!00S Q,00E0XSxS@`P -`Lp@P  %xP @B  8i000P 0# -PLp`@U *0PP  @U :Vw005j2j 0-L@PhP00h$j -L@MwQ 0S,0 Q h p-LA>K0C 0C@AM M BnK,$ `F `F($ P, ( T,1 ($ +  ,P$  Q0( P0(4 P@ 0\P  0ppQ 0~0S A^KPE0l @4 PsP( 8rP@(k(D ;;@P 0-LP @M00Q(K0 D  << ( P  0o ;; p-LP`M R00$0V: ph0A00  R0`V: 0  0 0  0 TLD8,꼗Ā, p-L@T`PM %* 1S@T:v00pv -L@M0S hwv -PLp 0U**  0@hPP`t 0U: 0X `PL00S g;; -L`M}K;0s`+ `0SP%ڸq}묠pP@夀  0 E 0p?p%Q \0`00,N}|>d;Ng;;;;@ -LSP`(Mp 0S @chP0 @% 0S0 08K8` P 0S00L0HKH D 0P 0 0 ;; -SRL,MP0 H L  R P"0SeDB00S0W 0|,2,,Ÿ 0@K@ P`P; X@DKP K p@0SH  D 0  Tx|h!0S`!00C0XL=|4 R000000 5|0  0S`P  `1SP00C0 | , |@T , 0S @T0S4 K4 K  40 0 \|TP @{4 R00000$ {dN;;;; --L M -?0LSPM M3 R! {3 NK!}K@DpGPk| pGE`#0R2>P0!``pTKd0 #O#0#PF" p00Q< ``y"P 0"+2PF"``p"0"0S V:00`FV 00DŽ`F 1KJ JR PK %Rj T ń@D R 0J "0PF" >Kp0CPcBZ{qa@ R@2 KA 0 P'TڜF{!0  P`K>@t>KpK0Cc@P1Al A p l< t| hL {!{00B,c0KlA\< A` X <d< z0mS|  0| 1PD"@`P{x0h 1PF"``pb H#[%[$ x;;< (;P$`3 p-PL0M@R ?0 P0s `0Spy  zp0@0pi@pt0``h d 00sp  App  I;; ;;; -L@P` pz hz( -LM@.00 0 ; -L@Mizhez( 0P0$a)z* -Lp@`P M K,TP,0@ 0P00gT, -LP|MP 0 0%S U 000SzXDdlx(Lh4HTp$0Jt Rş01 Pl0 Rtş01hv dmP 0b@ 0?$  ^mP  A0S cxğ00|v  0S \4 P $0$0 00 RP   0 v @ pTF dmP lP<[o` b l0@Cl0`s00WWI0 S@  dlP lP[p[pdl0VST gS Q0 d0lI[o` RXŸ018*0d: lP 0+$0 S!00՜Ř #TK`@KTK U  P0H0 0 K@\ P 0\I00d v  0S<@`K茀Kpp. p" `PEU `fB2<PGl<`Dl<A&lAA@ D$L4dPQ  p-L$@KP`  M  pQ *0S0 Q*0S00  @- 0@0P00p0P 00R`P'RT7`0m= 0\1 P7SL70c0\\ 511T' m-P \!L<DH<(D< -PLP#MM 0:S0/S Y wv@tv@@ TBNK@D@D |.PP $ P)p@ #\K(PE PE, +Pl*K8,g:K<cp _`$[@(W2W T TV>0VP2P*K83SS*K<#0R0RQ00100 K810 K< e b0RyQP P@ Z@Zl0 55 S`Z Z]@ L0SP7Q0T7@ SK ZZm  0Z0 m= 0QuM@  0Z Z  :K83SX7 0SX7 Z Z :K<3S\7 0S\70Z  PU0S0 C,S R-S+SP@-@  00L S 100C^00L S^ 0-LPK@ 0MP0 02c2c20 :R0 ;0P0 0 2c! 0:S0<0 P0 000 0-PL@0-SP +SP  U00c0 0 -L@M0JS; MS 00C S00[? 0P  0/S; 00   0 0  0rP  0.S 0gP  0.S 0 00 [? 0 -Lp@P`M diPiP0Sf S   02c2cz@Z}G ;RpS 0CQ,0 p Z8  102c2cQs,  i,0S@DdidPi@ @i/"/?B#?C@vi0P S B QZ,X 00010S Q 02c2cs002c2cs, -RL PDM\ `  0t?0\@Z!`0@T0 4P00` R(T 0 b00h0 L'PThY 00 0 0 SmM @\  @PYP`  P`@ v`0cY@0S,S ;S XKP@ 0V0R00SC ;Q,QI Q@Q` 05!!P7SL7`c \\"05!!P7S\\51P'%\7ST0 0f  P'L7R`c\X K 0c bL70`' h Td7 Phw@<KvP@ 0,SPKmP@ ^XKh 0]~{ al0`0ph d LP7`T'dh 0< KdX0@P KdT0@00000@d0@YhPThP@0! d0"b"bX3d0 TT0>CX0 E\ bZ@*0S' TKP@! -@LM 0S   h( -LM`0SX@ { 0R0lP bPhT=L< -L@MmthitL 0-L$oP@C Q0Sd^P0 rPP-P0S" Q 0m T, PLs0hP 0:S  bP L0{ plP,ls0hT=T<L<( -L@Mth tL -LpM0`V 7 Q 0\"P7S@ u.@T@0S@AL 0 K] P T70m=T 01(0@T 0\ @T0E)L<D p-LP0@M,`sO spL\= p-L`P,@Ms; spL -Lp@P/s 0{ Sx`p` `%s0 6UL0@0 m=R 040(000kP pX=P<( -L@M \= -L@ M -L@M \= -LR`M\, P@EJu=!@pu- 0T0\@AZfpf, 0e@~J:_?0TJDMDTpf{^Pf<@f<ffP00WEd@ {f0SufP@1!W([fWH@H`e1dazf_%_0EQPcrfdP nfO$O0DA @cffa`@`dpfPv>E 0C000Tp0 0W0!pb1W,0 $00 0JMTpGzPk\`PPU0`\L^ 0 0RY0 0RA`@ P0UM, -Lh -L@<K,M0 Q  -`pLP@0Te0c0he 0R 0R 0R 0R 0R 0c -LtM0 0 0TK0SPPK L@K< PeHK P_@KDK PXv PRH`V@pDP[?0V#U@@dP se0SmePP3!`bH` s[?P0,H`V@pDPDPKd@ Re0SLeP@T  <3 A0dVP` UDP H0 0D0 EPH` v A<PT;Q @ {>v. 0RT Ř s00 @ K K  TKBP T@DT00CP0ń0  4C4Є0 4\>`0 S; 2Y2200 R 0@S1P1P}R pRJ0 S @TpG4UZ0`S1PQPJP7 S K `VPE4UZLǕ0 00n0  TKP` 40R00 ? \0#S K    00:TKPT;0 T0  lPdfDPKU@@` d0SdP`80H `VH` PPKTK< P C,P<L< -Lp@P`M\ 0 -LpMM 0S0 0ł>K0C0C@8 0 4( ,8S PU10\11Z 0Q( K 0Q0 S<( J(K 5( K1$R<80<8 58 QZ<\8 8( K 1  01P'RD  88<0 S88 P<(XD(K 0!1H8 81aPǖ\04(@8<(X PHLLGdUPP Pe,8SHL'L 0 `bS00 0P<L< 0-L@,P6p  ^@.p0L0 0 Px 0 0JxD00  R J1u  0Q R@ZL< 0-L@KM$(Po@@`o0L 0-L@KPKM$o0 K  `Rʈo0A K  `RS Lo00 K  `RS o0C0L -LpDM0S d0d0 S P0@@P`8vΌ 0 0A@ P`%P=R000S  R R R00S 0 0S00S 0S00 R+= -L@MQ00Srl4w -L`RpM @t%  P`F @pT`P |g 0S"PE p-L@`PMLn R44 0PH @ npnpH -Lp`MHnPEuo8144Q0@0T0 W( 0W%  R0S P@T00CS0ynV@ `gV@ 0T0:#>T:`` R 0S 000/o @0S Mn(oEEHE  -p-Lr?K`K@QM@0 'n@On@0PALApKHA 0d0KaKcK`` \P bKp` hP Q-p0@p -@LT`pmMK(>KH0 PDmH%nH KTPNL0iKk K HjKxKl0Kh d@ x p@ h` dP x` pP -x0 m0 0 p-L@pPMn_0 CR 0@ `08_p0R \`$ -LP@M0 CR 0 00R \u$ --L ,$ --L M, 0-PL_ @Z_$C@0 -LM -L@K M PT4m*t1m*!.m* -L`@PM,m0j|0 Tp h0 *d01G lm, 9 0#\ 0-L@P00  1S01 08C810#   R]P $0bPP00C0P0P 00 U00S @]P 0 7]Pl 0 0 -PL`@MM 0S/P 1#P 8rT 0^hPP /P R.K B; B@rAK AAP0ppP 0S:S K%S Q 4 0S:S00bp0S0S0 L0C(S0S KQ*00S Q:0S KQ*00S Q:z gPpqoL| 2,H p-LlMp@  xKDaP  p D0`P`@iPu 0c( #(c4w"4#vAS DidPD0P 0Di p-LPp` `0c( #(c4"4#C@T0? 0c( #(c4"4#0cS L@TګkS00 0 bȠ`8 0 "8`b$#D ,$"a80! B8a#!T0? 0c( #(c4"4#0cS L@T0c( #aȠ !(c4"4#a,! ik 0 0 -pL@M P id Sk 0 00  -Lp!PBB0Sy ZcWAaPm  PkU0S'Z @PoP jU @Z @P PP@UT mV m R jZ/dP@ P$ 0/S `g0 S 9j00 R @Pp /P 0S/SPU U @P jPU @ZZ,0$fP00}8wH p-L PMppjl@`\BUPP @U8p @`@P 0F$ P @P`W!H0 0C-L4S ah 2 -L -LPp`L1FMMB@UP 0TPV  P8 /P  `ANK @D0 !0ES PPP0\ p GK A)Pt4: S H 2P8w< -bL8Q8MM p@T 0SBNK0@D^KSPE , 0 00  .K; BP a.K\ B; @P OP  i @H8wP 0-LPneP@ 0Sd0ee@T 0SD]e@T 0S(@0/P 8|PL| 2 p@-0@$PU \(Pp@ QP 0 P \` p`p@B -`P@L `p$b 0S$ $Uh0( ``$ht -L@Mh0 p-LANK@D0`DPM M @T 0 p@C@T  <0< 800 00 @ 0 ,04 #|| -L`M 0S 000 0,pKPP# , Y@T0e,0 PU@e $0S  (0\]PZ0eP0YP ,0S    0-LP@ P0@ -LpP@`M p$a 0S$$g0(0 K$0pP  V 0 0q -L@M6P ,0, 800 0, 0 004 !   -Lp<`P:a0P@ P(0$0PP U@aPFh -L@0M$ 0a0(0$0 -L, -L0 -L4 -L@M$ea8 p-L@`KPM P$ Kp0S4 $ 0pp-^A0LS  2 # ^ -L,PK` Mp$ (^,@ @$ T(  eP" 0 $(a80!8a #!Q*(0$P` 0 4 80R00CS  @0P(I@AP 01D A01!N ^TX QV00 100410$$1NP@ 0 0 P0 0 0 0  00)U0`$U` U` BPPU`U00RK PN U0SJDU00{\o! 0QQ PT00 00S 0 p-LP@`M4HP3 @ 0H D $00 @D{n 6Ϡ@DRCp0<30,<00@(@xH0  03S0ph -L`p4! P=P%[P W 1PU@8PP@Up_MW0T0pUM1 TpNM10Cs1 1!0C1CM10Cs10000 ^Kp A@0A/pp APP@18!0RPU@ $>mP SO00S0,1\ -LS0 M@h;}S00,1 -LSS0M@  \h!cS00,1]S0 -LRM@ 0 hJS00,1DS0 -L$M4 0 80 4 @ D  0  Pp < p000<@ 0dW@PPu 04@  cR$ @pW0 Rwwww 4 80kP<000<000< 000Dw P00StLxx11Q !004Q0@/Q0@p@-P@`0000  00  00  00  0 0 0 0 0 0  00  00  00  00  00  00  00  00  00# "0!0! " 0#0' $ &0%0% & $0'0+ ( *0)0) * (0+0/ , .0-0- . ,0/03 0 20101 2 00307 4 60505 6 4070; 8 :0909 : 80;0? < >0=0= > <0?0C @ B0A0A B @0C0G0D0F0E0`VE0F0D G 00 pG-0M @1p! 1 ! aQA 00000000000` P @ 0 0 0   000000000000 00$0 |xtplhd0 `\ 000|x0 0t!p0"0l#h0$0d%`0&0\(0'0,00 40 XTPL0 HD@<840) *(0X0+0T,P0-0L.H0/0D0@010<2803044005080< @0 ,($  0 607 8,090(:$0;0 <0=0>0?0@ 0A0B0C0D00X0 FD0E G 04C1!1 0Zލ -L@p`MTP K0 i  R C-00Q0! Q@@TBGPJ /#N$A0 1!01GP- 0@@0@@@@@@@@!R 20 2W4$0 4$ 0 4$0 40  0S S 20 2 N00Y Pp HH p  p  p KCPT K 0S`0SD  R ,3 50S( 0 2 0 2 "! 20 201P  0B00 1P0 51A@BPDB@@4118S0 1ɕ0!ɕ ;P 2 p   29 2 0 29 2 R 28 2dd" 0<K PnPSS: >0R 20 2D 20 2  0 0 0[0 0[ [[[[[@[P[`[p[ˀ[0 KKKKK@KPK`KpK00K喀K0 0 K K 0 0[ [0 K[[[[@[P[`[p[׀[ 0[ KKKKK@KPK`KpK劀K0KS:> 0R MO00S [P0@P[A`[Bp[0 @P` p  L0 0B4)0K* K)0[* [0 0#8C$+ K,0K+ [,0[F[G[H[ 0  80  8CR#H R^)04C$5 K60K5 [ 60[00 4 K030K 2 K010K2 [10[0 30[04 [ 040K 3 K020K 1 K10[02 [ 30[04 [ 0D  040K 3 K020K 1 K10[02 [ 30[04 [ 040K 3 K020K 1 K10[02 [ 30[04 [  040K 3 K020K 1 K10[02 [ 30[04 [ 040K 3 K020K 1 K10[02 [ 30[04 [ 08#^:^)0 $B-K0. K8#- [ .0[00 4 K030K 2 K010K2 [10[0 30[04 [ 040K 3 K020K 1 K10[02 [ 30[04 [ 0 040K 3 K020K 1 K10[02 [ 30[04 [ 040K 3 K020K 1 K10[02 [ 30[04 [ ^:? -L4M 2 Q1  8T 0 8CR#X RA 0 D 80 < @ T0C4P0 A0[5 [H0 X B0[6 [7[8[p[?[@[L0 9[X0:[;@[0 @P` p H  L0 0P T01 K20K10[2 [0 0#8C$3 K40KC [D[3[40[ 0^* 0 0,0K0+0K * K0)0K* [)0[0 +0[0, [ 0,0K + K0*0K ) K)0[0* [ +0[0, [ 0D  0,0K + K0*0K ) K)0[0* [ +0[0, [ 0,0K + K0*0K ) K)0[0* [ +0[0, [  0,0K + K0*0K ) K)0[0* [ +0[0, [ 0,0K + K0*0K ) K)0[0* [ +0[0, [ 0A$/ K08#/0[0K^00 [ : T 7^4*@0 , K08 + K# * K0)0K* [)0[0 +0[0, [ 0,0K + K0*0K ) K)0[0* [ +0[0, [ 0 0,0K + K0*0K ) K)0[0* [ +0[0, [ 0,0K + K0*0K ) K)0[0* [ +0[0, [  04C-K^.0K-0[0. [ 0%T0 %:@-0 M  @ @                                   Ѝ 0-LP@Q*-p0 f8p0 PPP A)C'CP0!C011C011C00 0 5800 0-LP@0SU 20 p A8P 20 2I00 800 -L `M{7S:>Pp4K0  –uO@R 40 0 00 , (@ $P 4 7 1 iI*R0< B$0A000P R0P R0P R R :0 RP! @ PLA 0 RP! @ -p-@ LT`KmM(r?K@0 PDII@qI@ rKTPNL0aKc K HbKpKd0K` \@ p h@ `` \P p` hP kp0 pI0 0 -LK MP -L`@dM F0SP  XS0 S0TXSq0q0dR0TXS00d0tXSd 0zS0!0V TP/U@DKPp0: SP H00Z! -~PH0S @a0P zP0 0 0a0000S |PH0S KuP |H0S0zSa00 |<0 <0tXSP 0S !0S:Q'  0R!ꔢܢТĢ 2 2 2 2 2 2 2 2Q  -R`LpP M ,` 0 @T 0S @RT 0 1 0A0@ &P@ W00 `P W, 01 83 B`1 , @01S -LM10 S , 4 a1@% 6P` 6P 1S0C10 0R00`- ,0 10a0`@40   \0 P 040S S4 L 0 <3Q B =  18 0 10S @*1p0 4\ PĜ\\4  0p p0 R! 00@0@p`P 00 @`P 0 A1=Q10 -LPpMP mP@ R0 X 0W@ P 0   0I@ATC@0`P -00000 0 0!00 -LDMP\X0 \ 9 22X0S) :S F 008 #8R ` \ 8#RXQ 1ST@K P\ \ K0\8#` T0S 2   0p@ 0 0(p"( b0Qs:0B7#(Y@!b: B4 00#8gC$ 0 00#8@@`10@1(0  0R5 1S 0S$08#80C00CY  4X  R 20 2 x\0 0("(I$01!0SY 01! 8#Y B40ŕ ŕ@ i 0` 0\P = j4 7T0Sj a4 . ,T@K 0ZP\ C; 3P08`#F<@K  #p 0K L 0 `` H0 k00PK ,KP0 LKd0H 8#R <@K #p 80KD0  `00@ `0 K04K G0@DK(0  E 0 3\  -PLp@  n3P` !B4 0 0 0 00!"(a0R:1S 0S  08#H "P@A 3AAP0000S0A 0(0C"S k"P 0 00C$ 0A4 1 p-L`@MP0SX 2QTJ TC`0?    p2P $ 0 40C0S% 08 #80 $ B 00P00S@ PT 20 2 T  Q3K PD 00@D 0 6300 -L`M4 0 P40080 #38, K Pv P4 0Ra Yo  3,p1 CS@!@ T 2 PPV 08#80C00C  S20!8#J40Hx @ 040p01 pH@@2 H2PP x 2  ;2PP 4 0R 24  *200PR  28, K$P 40P 0S Y  2,p1 CS@!@ T 1PP ("(s20@!8#J40Hx" 040p Z2 1PHP 08#80C00C!8#J4xp0 =2  1PP 4 0Rz -0L` M00 , KPP , Rpy 08#8 /0S g 2 0 Q8@#80C0Ƞ,S P @8#8("(0CRDA4R008#80C0NP  1Y   Z 08#8p@ 0("(0CRC0 108#80C3<P 1 1100#0\ -Lp M, ,4 14 S0C@@1T8  1PP! 08#` 0 0 0@0 8#80C0S40S PG0P 0@0 0  0 M1,0 R ,P@ @,%0P 710 0" ac-0#8C$ I0!Ƞ0 0\D  0L$8R#ȠA4055\ 8#80C0i88C#Ȱ  0LȠ4S  0B4,Ȱ 0  BB40  py 0  -LpP(  ^p 0 $@0`  } p 0 0!` a,0#8C$ 0 A!Ƞ0\D  0L$8R#ȠA4055\ 8#80C0j88C#Ȱ  0LȠ4S  0B4,Ȱ 0  BB40 (0  0S  8#Z B2B4105 5  p 0 Ƞ,SP  -L@P`pM 2  Q U08#80C00CUk:UQI08#80C00CU E4Y0p +0K,PK 000 0K0dPQ /P 0 K0 ,K+KP000  000 +[,0[4C$ 0  / l/P 0 0 K08#80C00CCĠ,0K+KP00  /L40 K+0K0p ,KP000EL40 K+0K0p ,K|P00oEĠ0K 0+K0p ,PK P [ 0- @LP0S0 S0/P 0 00//P 0 00|/A*A*A* -L@M0S 0f000 0 -Lv?K`K[MMPP0 @]KHAP)AP0PALA HAK P.x,`N4GĠh@ s0KqKdP T` p l tKrpK倀 x @TK21P@t0@ 0@0 0C4 0 p-LP@`Ml2 @2p -L@Mx" t t00 02  2  1S01t 8C810#0Sti1Pt 0 S 0AKK 2 Ā 0 0 u? pK 0K zPPh2%SJ`Z K  0Rp`0 dʀ" " UO0|2 2 2 )0K 0IZS98Lt          H888T888DTTh\l)0[S 0 || x2x0S2 x 0c2 |" |" +0*Y 00I SP! 00I S0PB0UPR ox2P0UPx20R x2 b|ˌ| ]P! 00I S0PBR U|| |"g x2`0x2 V\ \|  | 00AK\0S R/ :R  vs>@)0[ TS  | |"o`jjV$ P`UUڼ 0 0 SPEK0 T&t U K  0Ɵ0R0 P )0[տS K)0K 0P   Vb 2PdUUZڸe0 0 SPE`K 0 tEU K  0R`P0 1|50#\ K  0Rp0 @ J|" "2PcUU0 0 SPEğtK 0 +U K  |0R!0 ʀ2"R0S 0AK0 StKP t 0@tKP PAK tKPAKeYR)K/ $PSK3 @Q  @pRl2S| K  0R0 &PEUU c0 0 SPE`K 0 t Uʼ00`0 P  RcTPAK btKKPpRAKtKCPAKl\pR\S K  0RpP0 ? PeUU8a0 0 SPE`K 0 t#U K  0R`P0 | K`1 0P  tKPAAKPAK : atKP3'^K AK K  0R0 "K00 0Q0 p  p2 0l pQ0  tKPlAKtKPlAKuT1K(0 @Q  L K 0 0 R@ 20:l2PcUU2ڌ`0 0 SPE`K 0 tU K  0R`P0 p0 0Rp0 qtK`PAK[PAK XatKRPAKtKKPAKpRUhK .0c2KQ ?K dK 0 O)Ky/O P K 0 E0CpR0 0 0 K0 S"tKPWAKPEUU ڜb0 0 SPE`K 0 t Uʼ000 `P  RPAK / ctKP(pRAK|K 0 Qp0tKPAKPAK c"PbUU(c0 0 SPE`K 0 tU K  0R`P0 xtKPAKqPAK |dtKPAKa|^ 0 00 d"K 0 ?KcKQ0 MtKoP)0[AK8 iPAK$ % >&B`Pg( K0g@C1!`P0g|" 00S00 0gV0 0g0 `PV P00 U-0)0KPu`|  x2 Pox |  x2 Po x" |2  x2`x | x2 Pox u|"@x2 Po x"08CXo0e||| |" x2`0x2 0)0KW|  x2 P`x |  x2 P` x" |2  x2`x | x2 P`x |"@x2 P` x"08#X`0|" |" |2 x2`x  |  x2 P`x |"  x2 P`x2 |  x2`x | x2 P` x" |2@x2 P` x"08#X` |2 x2`x |"000S|2 0|2 s|  x2 P`x |"  x2 P`x2 |  x2`x | x2 P` x" |2@x2 P` x"08#X`x2 &~K@x `"K0)0Kp  GYgY"R " x2).K)K0x2 KP )K/ eP-0)0KEI#3Qpp@).K$P#3EI|2)KK;K'K |2 "GYgYpl l|ڈ\ggYEeEYeY" FYfY\@ ڈ"R @|2 0@0[S-0Cp\|" @@\0l@@L K l p2S @@| |"@ |20|2 KlQ|  ||2 x2 /0x2  |  x2 x |"  x2 x2 |  xx2x 2/| x2 2x 0|@ x2@$0x2  x2 x x2 |2P` 0x x |2 J|" bx2p Wp\x  *PB @gT@9@|2<| " p1Y 0)0K&~K`K@0S00 9KtP 3|̌GtKP*AKRjtx"%9 00 -L`PM @fT  ETeT 0,K0KT2,0Sp -0`P gTGT00  fT@ .P0@ 0 R*00 SC00 :0 g 00S 0@  P0h0 -`LQ-0+0@NM @a0`0` T000 pPK  - 000e- P@000e KU*0 KU0:g -LKMt+0K -LMj+ -PLP  U`pMⴀ) 0S R 0 P̐@$K00U0 P<U(0K0 0P@( 9@0 -PLM 0SD00P<P K0P@8@ -L`QSpPM⼠* 0S Q 0 P̐@(K00U0 P<U  ,0K 0 0P@,8@0 -L`QSpPM⼠* 0S Q 0 P̐@(K00U0 P<U  ,0K 0 0 P@,v8@0 -PLP  U`pMⴀ) 0S R 0 P̐@$K00U0 P<U(0K0 0,P@(;8@0 -L`PSPpM⼠* 0S P 0 P̜@(K00U0 P<U  ,0K 0 00P@,7@0 -LM80 P̒ K0 <P@7@ -LM80 P̒ K0 @P@7@!::.: S0 \P 0!::.: S0 \P00 -L`p<``6> U ` 6> 2.0 -LP@ Mf4Q6%z00 600 T`,@ ' ,KP0 ,0 `100 ,02 0 000S  @0 W 0C>C5 `0C0 C>@0C0!B@`@0K00 0@ -LP$K` M@0(Kp| 0$KP N0bŒ\0 :C% -L\M8 4 { 4T #00 0l0 t0 Ph0 x p0 L0 P0 4珏 T@T@ 0 0-S +ST T  R40T0  HC00 $iR 00 $nR 0Pz T@`/RX@ p9R 10W0C10W0`CT /RT p9RxRHp  EReR@ 7L0 T040 @ +RT@ @  -R 00B S4T $0R 10BS@ T00B /RT0 9R T@10 /RT@ 0C9RT@N<0 aPR\@ `@ W H@@0T@0n W࠱ࠣH@ @0 D =ZP@D P411H0C0 L)VP@ 0 Wd aD@K0dPU 01 0 +PU MU)M,"00t0d^ h8l6p4d2t08@TTP^  D@??%R' U@ 8`@P 0 U`p5I1 0 a&j3j 6V3 6VI5XH 0- d dd0 !l  5+ , K00KFh @@0Tp /P`,@0`lPCP B`P`\CN@6@npP`U\\pl`lPlQphp c@hh@ Vhh Zl l Ull Wpp lhR0 p 0t < 6P tK4/O P@ P*.O T<\P@p` p` P..O p`*4 6Z[ Z/O  P/O 0 < Rp` p` b0  0 a&jjZ h*l(p&t$<  0 <0SP@X46S / { P/  P - n P`K5I 0  0 !"*4*6CR51\6CP `q<0SO0p`qX46S X yO0yodY*"00dz\|j/ $ P e/ P@ FN0<Q- $0 6&BS ] < R 0 \K/ P@ PI  0 8?x1#::746SX1#::C )<P&X$46S tpt P5?55?5???p1DALPe < -P? %RUjU@ ڀ`@P 0 U`ʸ1 K 0 `K O P``K0 @K0 .O P@P3P@ R Rg@@0TʄA@1l 0 @ 0 @A11 0 @qt@ A }/O {P@[/O uP@AL4 T T 0RT T T T WT 20R) 10BST@0BPX@ QP U EW !p₠1W`\W 1p⃠W1Ѓ`PT 00B ST T0 0RT0 P 0B Q L T0T0 00S Sz.T RPToT 0(ST >X 0)PPT0  T@)PPT@ )PTXT T  (T .PTDT@L $X4PTT T@ TT P # -LM0 S, 0 0KI 1p8 4 8 1P 0("S*> 0V ,P0<4,P06CS|5P3 W W00X00SW00X\ /O0 `PP?`#P`P`0O/ ?`PP`V%^!000P 0\P2 0 00 ,P 00 0O/O0`*0`@0@ P` 0`X1v  Q R  P 46CU:  |0#03  ,K0f 0K`@@, Y ^Z,P0X W  ,P0^,P0W^,P0{0^0W@JJJ -RL@@pM `$0 `A$  0 J P@U0e $ e0(0 21%$ `e( $0 K(K$K$P0 P O4  b p-PL Mp _@@` P0Q S0 U UJA>`o0OoPJ0P` P 0 `p0`S  0 S43"?S04# 0 0 p-;PLDUEMoJP V 0T0U00S pp~UPD 000p5 D" 0a4000V`pJ -;L^,M< 8 * ^PoO0\ 8K< K`P80C8 </=O/D @ P`J0`  P`Po4KO 0\`P,0P`$+`P -;L`p45gSM 3^@$P 0 )V! W2 0 KN^00 ^0n03  1>0$02 $0  A AB B0Q0U|W V2$0 nQ$0 Q03  01$0 0P0S; V V ?" 0!P -;LˠP` 45fMà3^@p $0 #U V1$0 N^$  ^0n03  1. 0 0$ cAI Q \ U UP` S:\: 0S00 lp'V U Kn<Q0 Q 03  010$01$0 0P0S "; JϠ\  Ϡ\  z -;@T;LM/UT`ᠯ", (@ 4P 0 H X9 T^(K, KX0X4P 0K4 KO0,4sL'h$H .X0"R0#038"8( !6,(0Q ! 2Q 0C QCR ,p 4 7U`; #m^0U0X00S; -;PD;LM0/EU"4 0P ,@ (0 i Sc ST P ?45(K, K0PU4P0K4 K0P,0454( S b4 ࠑ}~ ,0 4 w?0S`,.(XȠ H,Ƞ0\R0b003  T`PT P T0\t 0000T\@?0\00, 00000b>30  €J -p`':@ナ7DL㨊 MXO<0KP  @KX@01@0 HA@ 0?48@K5 0 ( -LP@Kp4M)JJP@ 9GDFHPH%jP冪!L#U # 3(%(.&tXl *^.p0 #x p R2^`2 3 #S#3x@t#81!$ `Q@2P3P# P#3 Ƞx0 Ȍ "#R02 0@S!24Pl@p`h|\!2V Z[AH D L *L` H0 DK 0L@KHKP@DT0 0`0O/  p0 T U 00` 0O/` -LP@K`KPplM P>.JXJ@ .Jᄪ>e@J@ Tl P@XoO@$`@ 㪪< 0 , T@\@@ P4 @8@ @G l@Z; Z#`00`P` /O0`PP` \4K, K00K"8 P<`K<@ `0/0O`P<`K@K8 K0 8@@ @ K 6,0 0cU?@P 0@d0 4K *6ł\4 0 @PK :00^00S d0d ? @0 @PK   40x'x. p @p($X"( h&ht 2.$^0#03T#38.8(1,$H !F"X2R2 3#@<00aX bQ0C2\!C2`\h hD yp h ;#;S H A 4Kh&h !x x(,H"(X2,%X.\0#03^#38,8 Ƞ'.| 8 "# W2R02 3#h00c bWQ0C2Y0C2S`h0 gh  00  H DKD 0HKLKHL`dD H0c`P|K030# 3# h \L hH th0p@ 3 #030#0SPNh P DP p`/O 0 JP@Z ` 0O/A?O`PP` -p(  LMP`P' &:::S@ W @0 O00X64460 PP /0460@ -p(  LMP`P1 &:::S@" ?S@ S@0 O00W VUS S X64460 0460@ -p(  LMP`P1 &:::S@" ?S@ S @0 O00W VUS S X64460 0460@R b-  \ 1<20 0 \ ?\"00 0QS@-@0c  \1<0   \ ?\0 @0 @\ PT 0 0RR! BP0@00A S:Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  Rp@-P@l0` 0 0 4QPA^p0T0 $(B@pQP@-PR |0p@`0 0 $4(RBV@ PU0^0 $(B@ 00 @0QR0U000S00Q R0 00S00R  S0 Q   0R0000Q\- Q000S QL\Q0 -LK M , @@R SUQ 0R00 0S00-0U0Q0 0 Q0@-\@ 0P0U00Q00L0S \Q0 -LK M , @@ -Q@L0 M K00q 0 00q 0 00  - P00 0 Q 0 @-@sR00S U R00R  S0 Q  000R00@-@U R Q00000@-00@ 10 01 Ž@ 0- PL@1S0hDuP 10 "0 "10 -LP|K`p`MP@ t0: SBP@  0Q 00 ZH0K t 0d TP0 0$4 $ 0-L@P4s" P0 40 004 00C0  0S0@0 0 R00% 0_|d -LpM4Qs*%P`2 00C0 1R00000 S  000S0``` R 0 00 0 0 S  p0 0 R0```0 00P`  $P0P4P#  0H0  0S0```p0 0 R0```4S $ PO00 0 0A000 000 -L@MP  R 0 0 00 R0000 P  0-LP@T 0@T1P0Dp0 p-L`M$ 4R :@T  0P @T P4@0 4 p00C0 10R00000 Q 0 00 0 0Sppp -L`pM 4S$0P0P4P 4S000 $ $ 0A0 R 0S R 0-P@TUL P : P@  0 0 0 -pLM`P0 40 40K,0 0@ $@ ( b,K P $`` -LM`V - 8C810#0SgP 8@C8p`@ V`Vp  V 1+#,PP 00`S0p``  0@0 0C$ 0#0,0 d V`Vp B<B S=  P UP! 0 0e P0 00e0Sp`e 0PVPV: ,PPʿ c0 P0f  Z000yP P*0!` 0PU:{ P 0 0c  0P0 V,` `Vp ,0S? 0Y 1! P Q00P00S$ Q ,PPjY 00eS0p`e])P\, P 0 0e 0  000P D  xP0g0,0  0 02 P0-L@ F 0P 00z0 PP p-L`M (B10#p@Tp 0Pd@00U0  ,PP`@Up 0@0C$ 0p p-QL`P@MS 0 SVp pp@rP`&p`R @0S R 0-L@1 R= (B(10# "20#P0 0 P @0P <0 P $0C$ 0   B4 0 Q 08C8  0 0c0 0000W u 0-LCK K@M 0000%PPPC l l0 0 S  00C$ 00 @PP 0 0 ȱ4w p-L@P`dM 0CJxKPp04: S  Q;  0p  SL  p( $0R p0+ 0 p(( p-LPM|0 Rp0E0@^H1S0@L1`0 0@H1S` Et MH00@L1dN> p-LP`M0 Rp 0E\0@6H1S# KA0H1S:0@'00VHL1P1PP E@pU*0Ed0H1S0L1V0L1P10dN 0-LP@x0 R0 0ET 0 P10CSP1 L10CSL1 E0h H1S0 T0 dN -L@PKP@\M 6QT P 0P KSR0S0PK0 P@K4K@KT[S[P|K! {Kp O[P[tK sKT !x P,(B4=0K> KP[T [p0O[Sp[tC> [=0[4t [s0[Tx@4!hD$C{@[|0[DDĠ0FD1KLK/K30KHX GTh 9@K40K- K+K;K7PK24d0PEC4U0L0 0004 ,0!"((8!#8P PKT0 0HL D0!"((8!#8P P KT0  0@dDj8#U 04H^8#I 04HR8#x= 04HF0S X .@ xP PKTp @$@-^p@P`b0 4$3650C4^0 045C$0 @-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@Myh霁 -L8K0M *9 ;M1 r p-L`MX@ hP h P@ a  [  U0 TK0K p-LPM10 R@t`~  ;x  5<r 4 /l  ph(,KTK -LMq0CT#3o9I pP 0 `P#:Р0 < b@开BR* (P0 5#b B PP \s` p P 0h 00JJKK KLK -L@ 0 MP%:Qᘀ0* 00x@ ap@pP  3 $10PJKJK -L\MR $ 0@000Q 3 00P0 `V V3@ TQ 0SN p<0C>SThp|ȟԟܟR000@ 0S`Vd"0S@XB0SPR00P@4"0S,2   2:00 2p! 51Q1 \10nA0!0!1. 0!00i0tKp l0 t0 p0 (!000D1 R8 8 U00R00S`) 1 R0 0CR0V U0S0 R 0010,K ,0 (P $` `dC0 0CR04(dNKTKKS@4M ( $   L0 ,00S00 (K@ K5P@Z00@w02E*:B*I?*K<*69*6* -L@ 0M`pP` 0-LP@ 0M00*$P1 *  lp RCA 0\R#R! B -Lp@ M\P  S`` 0K`#L PPT $0W0 S  0 0 P -LQM` 0 70p0 w p1 0Q0VQ R@ 0P`  @TT- 02 0` 0S S0`@ 0R !P @0 0PVK 04S`Q# 00 @4q |V  0R @T`p0V0X00X0S(0  0  00C0 PY  V %D PV 04S`Q@40 K0K@T x p-PL`@PM pP`` 0S :c0 0` B0 * 0*p0S  0Sb0Q9 /4Q8" QQ  Q  Q0q00̤0 b0R0̤A0QQ0Q0̤0@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RAR@-@ R 00 R \T000Sa@\@-@@0 RdNTyy*x*v***b** -L 0 RvdN -L 0 RyvdN -L 0 RivdN -L 0 R[vdN -L 0 RMqvdN -L 0 R?cvdN -L 0 R1UvdN -L 0 R#GvdN -L 0 R9vdNp@-`P@?\ ʨ01 0S  ?\t@0\ d 0S  \#p?#= ?00c  P0p`N`K 0`K0`K01`K -L@M0S 00 p-LP`@M,0\ phuudN -Lu- -L -L 0 RudN -Lu -L400# _F r0 PwPy -L0:#:S "50#C x5pW+ +B4 0 PK0pp 0`P @0P X0`00 0 0C@  0qNJK;P0: S 0;C$ 0D L \KT0`   P0 K0`K 0SOR K y < pK0SO0Sq Kp80``3Pp Z00? 0<0 P8 0 @4 @PpPUtGZ @ "@  0Zt@\ 00\ 0@K 8 -L☀Kjp M@ P`'@K PPKx'0 ( 0K,p $ a+,K*.07P@ 0 q8a81P/p*PP8 *P@ P00CS^"Pq P000p xPW G+00*d`0 [008@[00hNlNpL -RLP @HMp\ > S8 _`V  4"@TXK,@ 0R[ 0008p P4 00 R 0 Ex \K@ 80K( X T 0,\ *[0 &[ 0PQx3L% -L0Pp@LMX0 P` U0 ,0 P, 4@ T@K0p (  0X P XK$@ 40K@4 0 0XPQx3L% p-L@PP`M P @Tp  P 0SQ 0S !` -RLPp|M 0 P P   D0 P 00C S$08 <0 4 , U 00CSU 00S0 Q| #`W009W0)7 -L`1M @0 \ppBQ# 0@T *P0!P@ 0T:0`yxp 0`z`` d`P 0LP<04 nzyxNNd, -LM@T@ '<0T&'<@0T@P0p0``P  d00 P D0   B@$0 yXyhyly|ydy -L0@&M&0Q6&@@ 6嬦 娖` @@06 $(BHT0S`v0 $(BH $6 @ JT,@0 48C\F 0 48CH % @ JT0 48C\] 0SP SG|5 P 0487 $(BH L JL5`T 0 4 S  0R0B0C04 U:;PP 0$4(Bh4B,ↀ` y9T$0S00pp/4$00000@0 48CH4`0 48CX 0e t0DShx $3 3  Q@@Bwpc 0C 0 $48(@ChBX@"0` S0`@0 0S 2P@0 48CH @ JT t0 48CV`0 |0 48Ch02 ^:Pa0F$ᆀ1` Ÿ0"x001!00 1 1  }0 0S 0 0000m00j00000p W:8Pp 0 00 XAh A\@h0\0`冀P@0ņl&( P@sP0Vhy\y`ytylyXy|y,jdyyL`xyyxNlp,dN -LM0S 0S00 0S5%00S|5|E00SP hhhhh%p00,p X5(0L5He0@Q 048C8  048C^@ 0 48C:^4Qǎ$0 48C p04ES 4 048tC8A@0\4P$P  048CP  0B  $048C8pG0,3#0`03#p3,  #0 48 CȠll3\ p x0^ pp0 S0 00R0LDShx %N  AAAA"塓P@P %U2%B#@%)|2  0h2  00PLSw$0!0! K0 0 b`B@!$0Sl1 0$0 0h 0RP3iP00P !00C? 0 }X0S0 P!000@p,@ P000@p,@ 000@P,@ p 00p0NNN$N^  NNNN~   *^y^yNl y N -LDrD@bP0800@Q ~ 0S0bS 0b`CV 0 R0 $0S00% 00fPCU\ 0 UZS*@C T>1p9 P 00@ 00@p" @ 000S@V0@$@ 000 00 000@0奄P  Pt@0 P呄P D<Uڝ, zNNNyN  G-0 00ܐZ (Ѐp R0`QP 048C8 048CP@ 0 48C:Ph0Q` 0 48 C0Z :NNyN^  ~   A-Pp`堀 048C8 048CP@ 0 48C:PH0Q@ 048C:P$ 00  ~   ^ -LMp 00^`@P 0 00\5:0@ @cP P0'2P0 Rl0 00 P00 < 000P000NNyNNNN 0-L@4P0S v0h'0;0NN -LT0S SD @0 40 0 NNNNN< 08 ,0$ $00 NNNNyN p-L`(PMP@L P0P0, 00pT -PL@M4  0P000ShN 0-L@P000P 00P00 0$0 PN -Q@L` 0RSpRW( SPUH  D0`$p 0 `ppp pN30S 0S -pL`P+P@ R*00 R: 0  P@ 00 - L  壂<ܵ|Q -L M  @0 @;tyd -LlM 0 哓P K&PHP0K0 Pp`< ͗PPA Y  P VK:P0 #PKAP p@T 00 B4 0  CA`V`F ᄔV`F z0VSp  -PL`Mp Bfp  EfpD V 0P<P @D H0K-8 0P ,@ HP @P 0 0P 2  Rp (0$0P(0 $0PS  00 -L`p@MP\5T0@T0 02T 2  P`@D P@  0p 2 0`0  @  ;00 -Lp M1"S *P8P, "! X0 0K, *P@`p` PUU 0Pv X"55: X 25<33 259  -Lp MZ3*rO0(p` P Ur/ R<@b1\ =P@ `PE1v c00 ,  0 K 0MPv  Z: Z 25<33 259R -LPM1"S *P8P"!+ b1V,0 ,K( B r*T 2%<## 2%)•\ \ 00T0#02S \ 0P`V:B v -LMRUB br*T 2%<## 2%),@ 0S @T*0S,l, K0( PP U@:B p-L`@MP0S-T T 0 0p(0 2S  $AP$00C$0 P 2:0 20Q 2Q A 00 p-L `MQ0  @("( PP 0p -Lp @M04P  wp 00!` a!A$0d 7#888C#Ƞ 0\T  0L$8R#ȠA4055\8#80C000n07#888C#Ȱ  0LȠ4S  0B4,Ȱ 02AA$0C 2 p-LPM@Q"%pp 2 ` @ P`ppbP`P 2 2` =00 -L`@$MP0S{ Tu 2   p  0$ 2  D0K< @K@0 $2 LpK 0P p$ 0i q 2P 2: 2 r L=b@ T 0P ?00 LpK0,0  0P8KL0  80 4 b@ T 0P ァ 00| -LSP@`Mp  1S PIP5 01  K1 0 W 87 P0! 2  0  1Q PP 01  10 xr?sτ P10 i -,0LpM,0 `1  PH 0#2=080 8C#X 08#Ƞ\@ 0P`1L@$Y  :Y 0 $00C0 0 $000  fB4 0 YP( 1, CS@!@ T `P Y 087 $000 087 $00CYP -@LP0d040n8#x  0b8#hpGĠ0!x08#h 0b0C GFCĠp`p0 -L₀` MP 0@$R0 , tcV, \0\ 08 #0ă l0G(V"# 40 $ b@Tʄ 0$0 0$B LL0A$ L@TL@40 @GA 0,`408 0CD BL0L8 @0 0000 40C$0L L A40Lo -L@ 04M Ƞ,< p@ oPD <0gP D0 0 0P L 0 00`4Z0H0 4P0 4S<@r 04c0 00 , @0g\0KH8 K8: 0@4Č c080 4 P08#8P0  4ZtPP 40bC$ H0 040cA0A$  0$ D000   #8 0LL  08# a0 4$0L0bL CH0P<@D  0 -LLM`@T X $B Ƞ0,x8L #8RP h0 \` ` 0 40C8S 0TL x 8#8pd0 4Sk 0TU 04d @c0e LdP HKD0 @PKH @ <@ BP0P' 0 4S  040< D0  R LMP  400008@#x\0 4S 040< D0  R TL!PT \  T000`QLz40n0CC$ 00h40cLL00h ČhBDLX @PX L 8#8`h0 QPX0` GL X@` NX 8K TKX0LP4^T 8Z\ 0X QX `L0@ ` * -LM, 0 40 8 P@ `p04S0R Y 0#\0K 100 0 1 \000 [ 0A$) K*K)0[* [0 0 4\ʌ0 4C+K,0K+ [ \,0[0uO00@0@0<  JPPBJ@ @00@ -LP`p Mx@ g  M>0R TI 0#\0K 100 0 1 \000 [ Z" <0W@  P@0P=]p  P O0 0Ⱍ@0@0< J PpBJ@ @00@0 4Tʌ0 4C)K*0K) [ \*0[0ڲ7P  -LPM 0H20AP` p 101  d 020 I$00 8a0Đ  00P -L`p M !0D 04 1A0C $ 0R140U00 ,P 18qW U 0, 1 CU@  Tp b @ TPU00D0Z $0@D @0@c T ZF !0@4  A@ @ D 010CY ?=2!I !U08#X&ʊU0 ^Pp40 D0@0 TD0Z 1@@ AU@ D$1 [!001 [c@/-"D0 01E $ @TP$ U D0T P U D0TU1@ >@b0T5Т 0$10C@/-"@cPpR  -p@L 08#(=1@0A0C$0>^ 18a!$ BVP ?=2!E.!h齝` p-LPD@K8`K,Mx00(K 0 (0 $0 0 b[ᔛ0s1  h[ R[ppT -L@M0ptP, 080 E0 ,00@0 0c8#,04 40UI4`E0 d@ 0 0b8#I4ᇐ 0p<0 G40Hp 40 8 , 0 0 0`a$`F F40`0 4@<00 p-L@Pa M1Q 0 R8!@ $@@P8 p8Q -LM@`P ČL8 ȠQ4 ,Ƞ00 , < i40 $ B(Z"ȠK 4 Z 0 08 \<#xN  04<0g8#h < o 0TP` PFE40lPAAZ 040 0 40`00,000Z0 `$ P040C8#Ƞ0 0 KP@00 0G8Z#x$4 Q 0!x40g8#h8  0TP` PFE40lPAA 040  040`8 K  0g8 40 00 ,P 4 0PT3 0ĒC Z 0 08 \#x8  040g8#h< <040FĠ<0 0` gH0H0 $ 040gC00 40`000@`P4$ Q040C8#Ƞv 0 0Z0  CC -L`Pp@ $0B8SpR[ QQ 0ᤚVP`U @W0  04S ^0S S0@N000N40@$ U 0L@@40L0 $ 000VV800C80 40  -L`pPM   a("HT 04S T   0  P  P0   ԘQ0  PpdP`  0$0b8#HT 04S -Lp`0 P@$4R ^ ^ 0ܙPS  04  0$ 4S ޅ0ޅ -L`pM@ $R,0 0 $Ri 0ĂP 0.  04Q,0h  \ 0UU 0㐙P   0 (!$10 $1  $1 0(!0 UUČ h Ƞ 0 @,XfHP$H`  0D, p  0S 1,0s0 0 040 SS0 :P` 0 8#HP 040 SS0 "P` @0 $R ` -L Mp0 0`@ Č P.\Pa`, +  040 SS0 P  0P@ 0,S 00 4 00P@(P Y 0 $R0(1 0 SS0 ᵘP  0 $$10$1 !$1 0 !$1 0-LP @Mp 1 00 -Lp M`@ 0 AQ PČl.P, @+P&P 0 P 0,S 00 4 y00 040 SS0 =P  0P@ -LP$M0 K<0 80K@ ~P@~0K@ڎ0  R <K@D 8#8@$ 0mD0S 000`  08 #P@0!Lt JĠpt`G`@@Ġ 040p0 $ <0000 Ă\ 0<D0SL0LP @Dt0 $ G@0 40p@KPJ4 0 !< 0@啗P -LpP`M@\ 2    R 1S *PyP^ 21 70" c1,0 ,K2(0 V_@GE G G G@G G GTG G@G(0$PP U 2 B 0U 24000 4K40 ,0U 2 E 0^P  2 V: 2$P  0 4 0EP0UP4 "0 4K9p &000PUP` 0PU0PU Uj0( ,K,0 z  m00M -Lp`$M!("\u"V00X0SkV h P 0V8#X@X V 2XF:0! (a0R/:0A7#U`!: B4 00#8hC$  000#8Q2 "0 "2 ` e > 0 PP202 #p` 08#X 4 K `p 00K<0 080  40 ..., where is one of: paxtargzipsysinstdisklabelcshnewfshostnamedomainnamemorewiconfigfsckfsck_ffsprogresspwd_mkdb././@LongLink \#invalid major numberinvalid minor numbertoo many fields for formatFailed open on %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive IS FLAWEDWARNING: partial archive write. Archive MAY BE FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to locate tape filemark.Unable to backspace tape over %ld pad blocksUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Unexpected EOF on archive fileInput archive name or "." to quit %s. Archive name > Empty file name, try again Quitting %s! Illegal file name: .. try again File name too long, try again Cannot open %s, try again Cannot save archive name.could not pipecould not fork-c-dccould not exec%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Can't fchdir to starting directoryCan't chdir to %sListing incomplete.Can't fchroot to "."Cannot chdir to %sUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sPremature end of file on archive readArchive I/O error. Trying to recover.Invalid header, starting valid header search.Archive I/O error, cannot continueUnable to append, archive header flawCannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.TRAILER!!!Cpio file name length %d is out of rangeCpio file name in header is corruptedCpio link name length is invalid: %lluCpio link name read errorCpio link name is corrupt070707File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %s070701070702File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %sFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot rename %s to %sCannot link to %s from %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfCannot link file %s to itselfCannot remove %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %s%s%s%sline %lu: %s: %sline %lu: %s: %s not specifieddevice numbersymlinkline %lu: %s: type mismatch: specfile %s, tree %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sThe -M flag is only supported when reading file list from stdinFirst node of specfile is not `.' directoryUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s -> %s %b %e %Y%b %e %H:%M%s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing bcpiosv4cpiosv4crcustarinsecureforce-localInvalid block size %sbzip2Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveUnable to use user and group databases in `%s'0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:XYZDestination directory was not suppliedblock-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdateverboseinteractiveconfirmationextractgunzipread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromcompressuncompressstrictatime-preserveunlinkuse-compress-programexcludechrootwrite_opt=nodirUnable to allocate space for option list+b:cef:hjklmopqrs:tuvwxzBC:HI:OPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C -CProblem with file '%s'TAPE/dev/nrst0reset-access-timemake-directoriesnonmatchinglinkpreserve-modification-timepass-throughrenameunconditionalpattern-fileswap-halfwordsUnknown -H format: %scpio: Known -H formats are:+abcdfiklmoprstuvzABC:E:F:H:I:LM:O:R:SVZ6Problem while reading stdin%s: Invalid combination of options: -%c These format options are not supported for %s %s = %s Invalid option nameInvalid options formatusage: pax [-cdjnvzO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjlmopqvwzHOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: cpio -o [-aABcLvzZ] [-C bytes] [-F archive] [-H format] [-O archive] < name-list [> archive] cpio -i [-bBcdfmrsStuvzZ6] [-C bytes] [-E file] [-F archive] [-H format] [-I archive] [pattern ...] [< archive] cpio -p [-adlLmuv] destination-directory < name-list Empty replacement stringInvalid replacement string %s%s while compiling regular expression %sUnable to allocate memory for replacement stringInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistantIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.cannot gzip while appendingCPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed write to file time tableFailed seek on file time tableFailed ftime table readFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to store mode and times for directory: %sCHKSUMHeader checksum %lo does not match %loBusted tar archive: has both ustar and old tar recordsnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format optionwrite_opt%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with extensions offLinkFileGNU Long %s found in posix ustar archive.Invalid type in GNU longlink %d Ustar %s header field is too small for %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sMODEUIDGIDMTIME/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//pathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %s%s: %s/group%s/master.passwdPathname too long.type=%s uname=%s uid=%u gname=%s gid=%u mode=%#o device=%#x nlink=%d link=%s size=%lld time=%ld.%ld cksum=%lu md5=%s rmd160=%s sha1=%s sha256=%s sha384=%s sha512=%s flags=%s optional tags=%s missing fieldunsetinvalid specification `%s'no parent noderealloc: %sstrunvis failed on `%s'%s: empty leaf element?*[root node must be the directory `.'unknown format `%s'invalid number `%s'too many argumentsmissing numbernot enough argumentsinvalid device `%s'existing entry for `%s', type `%s' does not match type `%s'memory allocation errorinvalid keyword `all'missing valueinvalid checksum `%s'invalid flag `%s'invalid gid `%s'unknown group `%s'invalid file mode `%s'invalid link count `%s'invalid size `%s',%s,invalid time `%s'invalid uid `%s'unknown user `%s'set(): unsupported key type 0x%x (INTERNAL ERROR)= cksumflagsgnameignoremd5md5digestnlinkoptionalrmd160rmd160digestsha1sha1digestsha256sha256digestsha384sha384digestsha512sha512digestunameblockcharfifounknown keyword `%s'unknown file type `%s'failed at line %lu of the specificationunknown type %dunknownuappnduchgnodumpopaquesappndschgsnaparchivedsappendschangesimmutableuappenduchangeuimmutable ,invalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxisclinuxnativenetbsdosf1scosolarissunossvr3svr4ultrixNetBSD gzip 200408308c jc@dXjdLfPhjlTnN\qdr7SptivVx19n.z-gz-z_z.taz.tar.bz2.Z.gzstdoutdecompressforceno-namequietrecursivetestfastbestGZIPzcatgzcatcdfhHlnNqrS:tvV123456789(totals)mallocstrdupmalloc failed%c%c%c%c%c%c%c%c%c%c%ssnprintf1.1.4deflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%cfailed to read stdin%s: unexpected end of fileinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression methodfailed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errorunknown error from inflate(): %derror writing to outputinvalid compressed data--crc errortruncated inputinvalid compressed data--length errordecompression errorcouldn't chown: %scouldn't chmod: %scouldn't chflags: %scouldn't utimes: %sBZh%s already exists -- do you wish to overwrite (y or n)? not overwritting %s already exists -- skippingcan't open %s%s has %d other link%s -- skipping%s already has %s suffix -- unchangedcould not create output: %scouldn't close ouputcouldn't stat: %soutput file: %s wrong size (%lld != %lld), deletingleaving original %s%s: unknown suffix -- ignored%s: not in gzip formatcan't read %s%.*s%.*s%s has %d other links -- skippingno -l with bzip2 filesno -l with Lempel-Ziv fileszdopen for read: %sfdopen for write: %sfailed infile fclosefailed outfile fcloseno -l for unknown filetypescouldn't close inputcouldn't close output%s: uncompress failedcouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)write to stdoutstandard input is a terminal -- ignoringfstatcan't read stdinunexpected EOFunknown compression format(stdin)zopen of stdinstandard output is a terminal -- ignoringCan't stat stdincan't stat: %s%s is a directory%s is not a regular filecouldn't fts_open %s%2.2d.%5s%%%s:%s -- replaced with %sNOT OK%s:%s %s method crc date time compressed uncompressed ratio uncompressed_nameread of uncompressed size %5s %08x %11s defla%12llu %12llu usage: %s [-cdfhHlnNqrS:tvV123456789] [ [ ...]] -c --stdout write to stdout, keep original files --to-stdout -d --decompress uncompress files --uncompress -f --force force overwriting & compress links -h --help display this help -n --no-name don't save original file name or time stamp -N --name save or restore original file name and time stamp -q --quiet output no warnings -r --recursive recursively compress files in directories -S .suf use suffix .suf instead of .gz --suffix .suf -t --test test compressed file -v --verbose print extra statistics -V --version display program version -1 --fast fastest (worst) compression -2 .. -8 set compression level -9 --best best (slowest) compression bzip2 initbzip2 data integrity errorbzip2 magic number errorbzip2 out of memory ,8@PX`hpxȕ   /sbin/reboot -q/sbin/halt -qftphttpftp_proxyhttp_proxy/bin/ksh/bin/cshunusedFFSv1FFSv2swapmsdosLFS40968192163843276851210242048asyncnoatimenodevnodevmtimenoexecnosuidsoftdepns9.iij.ad.jpns-wide.wide.ad.jplight.imasy.or.jpExit%s: Could not initialize curses <: page up, >: page downuntitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" %c: Help: exit: x, page up: u <, page down: d >usage: sysinst [-r release] [-f definition-file] Installation messages in EnglishYesNoAllSomeNoneOnOffDelete?installreinstall sets forupgradeWelcome to sysinst, the NetBSD-3.0.2_PATCH system installation tool. This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, lets upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, lets unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto an pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to install NetBSD? Available disksheadsaverage file size (bytes)mount point (or 'none')cylsecMBNetBSD uses a BSD disklabel to carve up the NetBSD portion of the disk into multiple BSD partitions. You must now set up your BSD disklabel. You can use a simple editor to set the sizes of the NetBSD partitions, or keep the existing partition sizes and contents. You will then be given the opportunity to change any of the disklabel fields. The NetBSD part of your disk is %d Megabytes. A full installation requires at least %d Megabytes without X and at least %d Megabytes if the X sets are included. Choosing megabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On modern ZBR disks, actual cylinder size varies across the disk and there is little real gain from cylinder alignment. On older disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierUnless specified with 'M' (megabytes), 'G' (gigabytes), 'c' (cylinders) or 's' sector at the end of input, sizes and offsets are in %s. You can now change the sizes for the system partitions. The default is to allocate all the space to the root file system, however you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories). Free space will be added to the partition marked with a '+'. MB Cylinders Sectors Filesystem Mount point?Size for %s in %s?Change input units (sectors/cylinders/MB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionAccept partition sizes. Free space %d %s, %d free partitions.Reduce partition sizes by %d %s (%d sectors).The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated to %d %s. Type enter to continue We now have your BSD-disklabel partitions as: This is your last chance to change them. Start %3s End %3s Size %3s FS type Newfs Mount Mount point --------- --------- --------- ---------- ----- ----- ----------- %9d %9d %9d %-10s %-5s %-5s %sShow all unused partitionsPartition sizes okThe current values for partition `%c' are, Select the field you wish to change: MB cylinders sectors ------- --------- --------- FStype: %9s start: %9u %8u%c %9u size: %9u %8u%c %9u end: %9u %8u%c %9u block size: %9d bytes fragment size: %9d bytes avg file size: %9d bytes (for number of inodes) avg file size: 4 fragments newfs: %9s mount: %9s mount options: mount point: %9sToggleRestore original valuesSelect the typeother types%s Special values that can be entered for the size value: -1: use until the end of the NetBSD part of the disk a-%c: end this partition where partition X starts size (%s)%s Special values that can be entered for the offset value: -1: start at the beginning of the NetBSD part of the disk a-%c: start at the end of previous partition (a, b, ..., %c) start (%s)Badly formed sector number Select file system block sizeSelect file system fragment sizePlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Okay, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Okay, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. Can't get properties of %s, error message was: %s. I was unable to delete %s, error message was: %s. I was unable to rename %s to %s, error message was: %s. As part of the upgrade procedure, the following have to be deleted: As part of the upgrade procedure, the following directories have to be deleted (I will rename those that are not empty): The directory %s has been renamed to %s because it was not empty. Cleanup of the existing install failed. This may cause the extraction of the set to fail. Partition %c's type is not 4.2BSD or msdos and therefore does not have a mount point.mount of device /dev/%s%c on %s failed. The extraction of the selected sets for NetBSD-3.0.2_PATCH is complete. The system is now able to boot from the selected harddisk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-3.0.2_PATCH is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. The afterboot(8) manpage is another recommended reading; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-3.0.2_PATCH is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. At a minimum, you must edit rc.conf for your local environment and change rc_configured=NO to rc_configured=YES or reboots will stop at single-user, and copy back the password files (taking into account new system accounts that may have been created for this release) if you were using local password files. Unpacking additional release sets of NetBSD-3.0.2_PATCH is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. At a minimum, you must edit rc.conf for your local environment and change rc_configured=NO to rc_configured=YES or reboots will stop at single-user. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. If you are not ready to complete the installation at this time, you may select "none" and you will be returned to the main menu. When you are ready at a later time, you may select "upgrade" from the main menu to complete the installation. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are not needed by all installations. You may choose to install all of them (Full installation) or you select from the optional distribution sets. The following are the %s site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. host: %s base directory: %s set directory: %s user: %s password: %s proxy: %s e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the .tgz files and must be nfs mountable. host: %s base directory: %s set directory: %s The directory %s:%s could not be nfs mounted.Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the .tgz files. device: %s set directory: %s Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the .tgz files. device: %s file system: %s base directory: %s set directory: %s Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the .tgz files. base directory: %s set directory: %s file systemThe CDROM /dev/%s could not be mounted.%s could not be mounted on local device %s.%s is not a directory%s does not contain the mandatory installation sets etc.tgz and base.tgz. Are you sure you've got the right directory?I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?I have found the following network interfaces: %s Which device shall I use?You did not choose one of the listed network devices. Please try again. The following network devices are available: %s Which device shall I use?To be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 numberServer IPv4 numberIPv4 NetmaskIPv6 name serverIPv4 name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Primary Interface: %s Host IP: %s Netmask: %s IPv4 Nameserver: %s IPv4 Gateway: %s Media type: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Primary Interface: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Nameserver: %s IPv4 Gateway: %s Media type: %s IPv6 autoconf: %s IPv6 Nameserver: %s Are they OK?Please reenter the information about your network. Your last answers will be your default. Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory %s: %s. Install aborted. Ftp could not retrieve a file. Do you want to try again?What directory shall I use for %s? Do you want to delete the NetBSD sets from %s? (You can keep them to install/upgrade a second system.) The next step is to fetch and unpack the distribution filesets. During the extraction process, what do you want to see as each file is extracted? Release set %s does not exist.Continue extracting sets?All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. The installation is aborted. Please recheck your distribution source and consider reinstalling sets from the main menu.Your choices have made it impossible to install NetBSD. Install aborted. The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save /usr/X11R6/bin/X as /usr/X11R6/bin/X.old, because the target disk already has an /usr/X11R6/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target /usr/X11R6/bin/X and /usr/X11R6/bin/X.old. If /usr/X11R6/bin/X.old is from a completed upgrade, you can rm -f /usr/X11R6/bin/X.old and restart. Or if /usr/X11R6/bin/X.old is from a recent, incomplete upgrade, you can rm -f /usr/X11R6/bin/X and mv /usr/X11R6/bin/X.old to /usr/X11R6/bin/X. Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? (No allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? (No aborts the install process.) Making device nodes ... It appears that /dev/%s%c is not a BSD file system or the fsck was not successful. The upgrade has been aborted. (Error number %d.) Your file system /dev/%s%c was not successfully mounted. Upgrade aborted. target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? What floppy device do you want to use? Please load the floppy containing the file named "%s". Could not find the file named "%s" on the disk. Please load the floppy with that file on it. If this was the last set's disk, hit "Set finished" to continue on the next set, if any.The floppy was not mounted successfully. You may: Try again and put in the floppy containing the file named "%s". Not load any more files from this set and continue on the next one, if any. Not load any more files from floppy and abort the process. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseSystem (/etc)Compiler ToolsGamesOnline Manual PagesMiscellaneousText Processing ToolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX contrib clientsX11 programmingX11 Misc.%-27s %3s Select all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions %c and %c overlap. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Config file %s is not a regular file. Out of memory (malloc failed). Could not open config file %s Could not read config file %s Command %s failed. I can't continue.The only suitable partition that was found for NetBSD installation is of the old NetBSD/386BSD/FreeBSD partition type. Do you want to change the type of this partition to the new NetBSD-only partition type?Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listPlease choose the password cipher to use. NetBSD can be configured to use either the DES, MD5 or Blowfish schemes. The traditional DES scheme is compatible with most other Unix-like operating systems, but only the first 8 characters of any password will be recognised. The MD5 and Blowfish scheme allows for longer passwords, and some would argue that it's more secure. If you have a network and intend to use NIS, please bear in mind the capabilities of other machines on your network. If you are upgrading and would like to keep configuration unchanged, choose the last option "do not change". The disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. Don't forget to check the file system mount points for each of the file systems that are to be mounted. Press to continue. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-3.0.2_PATCH Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuNetBSD-3.0.2_PATCH UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemyes or no?Hit enter to continueChoose your installationSet sizes of NetBSD partitionsUse existing partition sizesMegabytesCylindersSectorsSelect mediumFTPHTTPNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationCustom installation** hidden **HostBase directorySet directoryDirectoryUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againGive upIgnore, continue anywaySet finishedAbort installPassword cipherDESMD5Blowfish 2^7 rounddo not changeDeviceFile system Select IPv6 DNS serverother Perform IPv6 autoconfiguration?Perform DHCP autoconfiguration?Root shellSelect set extraction verbosityProgress bar (recommended)SilentVerbose file name listing (slow)If you booted from a floppy, you may now remove the disk. Installing the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the first serial port as the console. Installing boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors ------ ---------- ------- ------- %-6x %-10d %-7d %d This disk matches the following BIOS disks: BIOS # cylinders heads sectors ------ ---------- ------- ------- %-1d: %-6x %-10d %-7d %d Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Kernel (JORNADA720)Kernel (IPAQ)We are now going to install NetBSD on the disk %s. NetBSD requires a single partition in the disk's MBR partition table, this is split further by the NetBSD disklabel. NetBSD can also access file systems in other MBR partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single MBR partition used to cover the entire disk. If you want to install more than one operating system then edit the MBR partition table and create a partition for NetBSD. A few hundred MB is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least 5GB if you want to build NetBSD itself. Which would you like to do?Edit the MBR partition tableUse the entire disk Total disk size %d %s. Start(%3s) Size(%3s) Flg Kind ---------- ---------- --- ---------------- %10d %10d %c%c%cYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OK kind: %s start: %d %s size: %d %s end: %d %s active: %s install: %s%ssize (maximum %d %s)Invalid numeric: Too large: Space allocated: Space at %d..%d %s (size %d %s) %s%sStart (in %s)Partition kind (0..255)No free spaceThere can only be one extended partitionThe Current MBR partition table is shown below. Flgs: a => Active partition, I => Install here. Select the partition you wish to change: Partition table OKDelete partitionDon't changeOther, input number Do you want to re-edit the MBR table (or abandon the installation)? There is no NetBSD partition in the MBR partition table.There are multiple NetBSD partitions in the MBR partition table. You should set the 'install' flag on the one you want to use.Setting up the DOS partition table ... Rewrite of MBR failed. I can't continue.MSGTXTS [+msg_prompt_win: newwin(%d, %d, %d, %d) failed mydisk/usr/INSTALL/hpcarm/binary/setsftp.NetBSD.orgpub/NetBSD/NetBSD-3.0.2_PATCH/bsd/releasecd0asd0arelease/targetroot3.0.2_PATCHhpcarmTERMsysinst: environment variable TERM not set. Dr:f:sysinst: screen too small sysinstmsgs.HOMELog ended at: %s # Script ended at: %s sysinst terminated. release = %sa $0machinemachine = %sdist dirdist dir = %sext dirext dir = %sftp hostftp host = %sftp dirftp dir = %sftp prefixset dir = %sftp userftp user = %sftp passftp pass = %sftp proxyftp proxy = %snfs hostnfs host = %snfs dircd devcd dev = %slocal devlocal dev = %slocal fslocal fs = %slocal dirlocal dir = %stargetroot mounttargetroot mount = %sdistfs mountdistfs mount = %sdist postfixdist postfix = %s/usr/X11R6/bin/X/usr/X11R6/bin/X.oldDynamic menu creation failed. sysinst.logLog started at: %s log filesysinst.sh#!/bin/sh # Script started at: %s script file:%%.*s%srealloc(argv) for %s------------------------------sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s vasprintf(&scmd, "%s", ...)%s%.*s %%%02Xeongreipipgiffaithnsippppstriptun/sbin/ifconfig -a 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.lo0: mediaopt sldefaultmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo $gateway; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver -a "${address#*:}" = "${address}" ] && { echo $address; break; }; donedomain-name0xff0000000xffff00000xffffff00/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s EOF /sbin/ifconfig lo0 127.0.0.1/sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ping -v -c 5 -w 5 -o -n %s-a -_.+!,-_.+!,//usr/bin/ftp %s%s://%s%s/%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%s# # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s hostname=%s /etc/ifconfig.%scat <>%s%s up %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroute="%s" dhclient=YES dhclient_flags="%s" /tmp/dhclient.pid/sbin/dhclient%s -q -pf /tmp/dhclnt.pid -lf /tmp/dhclient.leases %s/tmp/dhclient.leasesCould not open file /tmp/dhclient.leases. Could not open /tmp/dhclient.leases Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumcd9660adosfilecoreext2fsntfsraidvnd:no_mbr%s -f /tmp/disktab %s '%s'disklabel -w -r-i/sbin/newfs %s%.0d/sbin/newfs -O %d -b %d -f %d %s%.0d-tffs -o async/sbin/newfs_lfs -b %d-tlfs-tmsdos%s /dev/r%s%c/etc/etc/fstabCreating %s/etc/fstab. cat <%s/etc/fstab Failed to make /etc/fstab! # /mnt/dev/%s%c none swap sw 0 0 ???,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid,softdep%s/dev/%s%c %s %s rw%s%s%s%s%s%s%s%s %d %d /dev/%s%c /tmp mfs rw,-s=%d swap /tmp mfs rw,-s=%d kernfs /kern kernfs rw procfs /proc procfs rw,noauto /kern/procnoauto/sbin/fsck_%s%s -p -q /dev/r%s%c/dev/r%s%c%s -p -b 16 -c 4 /dev/r%s%c%s -p -c 3 /dev/r%s%c/dev//dev/%s %s ffs %s/dev/%s %s ufs %s/dev/%s%ckern-JORNADA720kern-IPAQbaseetccompgamesmanmisctextxbasexcompxetcxfontxserveretc.tgzbase.tgz/dev/bin/sh MAKEDEV all/dev/fd0aunloading from floppy/sbin/mount -r -t %s %s /mnt2/bin/cat %s >> %s%s/sbin/mount -rt cd9660 /dev/%s /mnt2/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%s/.sysinstprogress -zf %s tar --chroot -xhepf -tar --chroot -zxhepf %star --chroot -zxhvepf %s/usr/sbin/postinstall -s /.sysinst -d / fix%s/%s%smkdir /mnt2 chmod 755 /mnt2 /bin/rm -f %s/%s/%s%s/bin/rmdir %s/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfsTZ/usr/share/zoneinfo//etc/localtimeUTCzoneinfo Please consult the install documents./usr/share/zoneinfo/%s/etc/passwd.conf/etc/passwd.conf.pre-sysinstdefault: localcipher = old ypcipher = old default: localcipher = md5 ypcipher = md5 default: localcipher = blowfish,7 ypcipher = blowfish,7 passwd -l rootchpass -s %s rootcat <>%s/etc/rc.conf sed -an -e 's/^rc_configured=NO/rc_configured=YES/;H;$!d;g;w %s/etc/rc.conf' %s/etc/rc.conf/sbin/dump_lfs/sbin/fsck_lfs/sbin/mount_lfs/sbin/newfs_lfs -async noatime nodev nodevmtime noexec nosuid softdep FAT/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s /dev/%s%c %s%s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /usr/sbin/bad144 %s 0/sysinstrm -f %s/.termcap/.profileNetBSDExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32Windows FAT32, LBANTFS volume setSolarisUnknown%s. %scan't delete extendedmain-extended mixup%*s %*s (%s) %.*sUser answered no to destroy other data, aborting. Unknown (%d)%d%s/usr(%u)%6u%8s%10u%10u %c %s/tmp/disktabCreating disklabel %s cat <>/etc/disktab Could not open /etc/disktabFailed to open /etc/diskabel for appending. %s|NetBSD installation generated:\ :dt=%s:ty=winchester:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%d:\ :se#%d:%s\ :p%c#%d:o%c#%d:t%c=%s:b%c#%d:f%c#%d:ta=4.2BSD:$,4<DLT\dh ,8@PX`hpx4L\$8D$,4<DLT\dh ,8@PX`hpx$,4<DLT\dh ,8@PX`hpx%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%d:%sts#%d:p%c#%d:o%c#%d:t%c=unknown%d:b%c#%d:f%c#%d:SMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyATAPIcgdflashBCFINRWb:ef:irs:twioctl DIOCWLABELunknown disk type: %s%s? [n]: NetBSD slice at %u, partition C at %u Write outside MBR partitionioctl DIOCSDINFOlseekioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskInvalid extended chain %x <= %xCan't read master boot record %dInvalid signature in mbr record %dno disklabeldisk label corruptedcould not get initial labelioctl DIOCGDINFOgetlabelsector()getlabeloffset()Bootstrap doesn't leave room for disk label%.*s|Automatically generated label:\ :dt=se#%d:ns#%d:nt#%d:sc#%d:nc#%d:\ :%ssu#%d:EdDk.aXXXXXXre-edit the label? [y]: EDITOR/usr/bin/viforkline %d: too few fieldsline %d: syntax errorline %d: invalid format# line %d: warning, unknown disk type: %sremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorsectors/tracksectors/cylindertracks/cylindertotal sectorsrpminterleavetrackskewcylinderskewline %d: bad %s: %sheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: warning, unknown filesystem type: %ssector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %d to %dwarning, partition %c: size 0, but offset %dpartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlap[-rt] [-C] [-F] disk(to read label)-w [-r] [-F] [-f disktab] disk type [ packid ](to write label)-e [-r] [-I] [-C] [-F] disk(to edit label)-i [-I] [-r] [-F] disk(to create a label interactively)-R [-r] [-F] disk protofile(to restore label)[-NW] disk(to write disable/enable label)or usage: print this menumake partitions contiguousprint disk label and current partition tablechange label informationname the labelprint current partition tablequitrounding (c)ylinders (s)ectorsWwrite the current partition table%s %s [a-%c] define named partition yesAutomatically adjust partitionsInvalid answer# Current values:Disk type [?]Supported disk typesUnknown disk type: %sDisk nameNumber of partitionsInvalid number of partitions `%s' Sector size (bytes)Invalid sector size `%s' Number of sectors per trackInvalid number of sectors `%s' Number of tracks per cylinderInvalid number of tracks `%s' Number of sectors/cylinderInvalid number of sector/cylinder `%s' Total number of cylindersTotal number of sectorsHardware sectors interleaveInvalid sector interleave `%s' Sector 0 skew, per trackInvalid track sector skew `%s' Sector 0 skew, per cylinderInvalid cylinder sector `%s' Head switch time (usec)Invalid head switch time `%s' Track seek time (usec)Invalid track seek time `%s' Label nameRoundingRounding can be (c)ylinders or (s)ectorsFilesystem type [?]Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x')Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining)Bad size `%s' Size `%s' out of range Label diskLabel not writtenLabel writtenUnknown command %s [%s]%s: %gc, %us, %gMUnit error %c partition %5u %5u %5u %5u %5u %6u %20.20s # (Cyl. %6u- %6u# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %d %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10d %5u %5u %5.5s %d partitions: # size offset fstype [fsize bsize cpg/sgs] csh: Trying to start from "%s" ..............// /Allocated memory from 0x%lx to 0x%lx (%ld). LOGNAMEUSER/usr/bin:/bin:/usr/pkg/bin:/usr/local/binWarning: no access to tty (%s). Thus no job control in this shell. /etc/csh.cshrc/etc/csh.loginlogout exit *?_-.[]~=/etc/csh.logoutYou have %smail. new New mailMail%s in %s. dirscsh: %s PWD%d ~%s%s%c~%s [

] [|+] [+]$?<$?#$#-*htrqxes$\`<<Syntax Error%s is not allowedWord too long$< line too longNo file for $0$? not allowed hereIncomplete [] modifier$ expansion must end before ]Bad : modifier in $ (%c)Subscript errorBadly formed numberNo more wordsMissing file nameInternal glob errorCommand not foundToo few argumentsToo many argumentsToo dangerous to alias thatEmpty ifImproper thenWords not parenthesizedImproper maskNo such limitArgument too largeImproper or unknown scale factorUndefined variableDirectory stack not that deepBad signal numberUnknown signal; kill -l lists signalsVariable name must begin with a letterVariable name too longVariable name must contain alphanumeric charactersNo job control in this shellExpression SyntaxNo home directoryCan't change to home directoryInvalid null commandAssignment missing expressionUnknown operatorAmbiguous%s: File existsSubscript out of rangeLine overflowUnknown variable modifierNo such jobCan't from terminalNot in while/foreachNo more processesNo matchMissing %cUnmatched %cCan't make pipeusage: jobs [ -l ]Arguments should be jobs or process id'sNo current jobNo previous jobNo job matches patternFork nesting > %d; maybe `...` loopNo job control in subshellsBadly placed ()'s%sThere are suspended jobsNo other directoryDirectory stack emptyBad directoryusage: %s [-lvn]%sNo operand for -h flagNot a login shellDivision by 0Mod by 0Bad scaling; did you mean "%s"?Can't suspend a login shell (yet)Unknown user: %sNo $home variable setusage: history [-rh] [# number of events]$, ! or < not allowed with $# or $?Newline in variable name* not allowed with $# or $?$? or $# not allowedIllegal variable nameNewline in variable indexExpansion buffer overflowVariable syntaxBad ! formNo previous substituteBad substituteNo previous left hand sideRight hand side too longBad ! modifier: %cModifier failedSubstitution buffer overflowBad ! arg selectorNo prev search%s: Event not foundToo many )'sToo many ('sBadly placed (Missing name for redirectAmbiguous output redirectCan't << within ()'sAmbiguous input redirectAlias loop!# History loop%s: %s. Wrong ArchitectureMalformed file inquirySelector overflowInvalid Error%d hits, %d misses, %d%% %s: aliased to %s: shell built-in command. %s: Command not found. <>erwxfdzopls %job%job &login/usr/bin/loginendifthen/endifendsw%o cputimesecondsfilesizekbytesdatasizestacksizecoredumpsizememoryusememorylockedmaxprocopenfilessbsizehoursminutesmegabytesunlimited%-13.13s%ld %s hard%s: %s: Can't %s%s limit (%s) %6d @aliasallocbgbreakbreakswcasecdchdircontinueelseevalexecexitfgforeachglobgotohashstathistoryjobskilllineditlogoutnicenohupnotifyonintrpopdprintfpushdrehashrepeatsetenvshiftsourcestopsuspendumaskunaliasunhashunlimitunsetenvwaitwhichwhile :^$*-%-$*(=~${}:Reset tty pgrp from %ld to %ld Use "logout" to logout. Use "exit" to leave csh. Bad seek type %d ;& missing format character#-+ 0*0123456789%s: invalid directiveunknown escape sequence `\%c'format %s too complex %s: invalid field width%s: expected positive numeric value%s: expected numeric value%s: not completely convertedUsage: %s format [arg ...] [%d]%s %c %5ld %-23sRunning Exit %-18dDoneBUG: status=%-9o | (core dumped) (wd: (wd now: BUG: waiting for background job! Exit %d BUG: process flushed twice[%d] %ldSIG%s: Already suspended %s: %s %s: Badly formed number %d: %s csh: setpgid error. +-Warning: ridiculously long PATH truncated %lu%%%%lu.%%0%ulu%%%%%Uu %Ss %E %P %X+%Dk %I+%Oio %Fpf+%Ww0.0%%ld%ld.%01ld%d%dcannot seek temp filecannot read temp filecannot write temp fileinvalid address%sed.XXXXXX%s/ed.XXXXXXw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterp unexpected end-of-fileno previous command& cannot open input filecannot close input file%lu newline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\usage: %s [-] [-sxE] [-p string] [name] p:sxE ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixinvalid redirectioncannot nest global commandsinvalid destinationno previous substitutiondestination expectedunexpected command suffixno current filename%ld unexpected address!unknown commandno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patternunbalanced brackets ([])trailing backslash (\)infinite substitution loopnothing to undo%s: can't read disk label; disk type must be specifiedAABTBBBBC CHC\C|CCCCD 4.3BSD, 1 ==> FFS, 2 ==> UFS2-S secsize sector size-T disktype disk type-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %%-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameusage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]where fsoptions are: illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a UFS1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck -b #) at: %*lld,Error making filesystem Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too bigcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0fsinit: inode value out of range (%d). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s isblock bad fs_fragshift %d clrblock bad fs_fragshift %d setblock bad fs_fragshift %d ilog2: %d is not a power of 2 getrlimitsetrlimit%s: invalid APPLE UFS checksum. found 0x%x, expecting 0x%x%s: APPLE UFS label name too long, truncated. sethostnamegethostnameusage: %s [-s] [name-of-host] setdomainnamegetdomainnameusage: %s [name-of-domain]  SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. --------------------------------------------------- Search patterns may be modified by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. * and @ modifiers are recognized in less mode only. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceeded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Forward search skips current screen. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c -C .... --clear-screen --CLEAR-SCREEN Repaint by scrolling/clearing. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop long lines. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. --no-keypad Don't use termcap keypad init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. CNTL-RightArrow ESC-RightArrow ESC-w Move cursor right one word. CNTL-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. CNTL-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. CNTL-DELETE ESC-DELETE ESC-X Delete word under cursor. CNTL-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. CNTL-L Complete filename, list all. +?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0ascii8bcccbcc18b95.b8bcccbcc12bc5b223.bebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.biso88598bcccbcc18b95.33b.koi8-r8bcccbcc18b95.b128.next8bcccbcc18b95.bb125.bbutf-88bcccbcc18b.latin1latin9invalid chardefchardef longer than 256invalid charset name*s<%X>LESSBINFMTLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8ESC^%cLESSSEPARATOR!done|doneNon-match First-file EOF-ignore Keep-pos Regex-off (P)There is no --%s option[Press 'h' for instructions.] [Press space to continue, 'q' to quit.]less %sungetcc overflow@/\less/\help/\file/\@Examine: Cannot edit standard inputCannot edit file processed with LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filemark: goto mark: Command not available|mark: Brackets: LESSKEY_SYSTEM/etc/syslessLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s""%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s*SHELL%s %s %sLESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x -- %sLESSCLOSE...skipping... Cannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARS%*s ~ Calculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeLESSSECURELESS-E-m-G-fMOREVISUALLESSEDIT%E ?lm+%lm. %fWARNING: terminal is not fully functionalNo filenames allowed with -t optionCannot allocate memoryInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Line number is required after -ltags support is not availableTags file "%s"less Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %ssearch-skip-screenbuffersauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-fileno-lessopenlong-promptline-numberslog-fileLOG-FILEpromptsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollwindowquotestildeno-keypadSearch includes displayed screenSearch skips displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by clearing each lineRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: Position target at screen line %dDon't display a status columnDisplay a status columnDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: Horizontal shift %d positionsUse keypad modeDon't use keypad modeketiclcmsombvbbcho|^srLESS_TERMCAP_LINESliCOLUMNScokrklkukdkPkNkh@7kDhcxndasgInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGSSIOCGIFFLAGSSIOCSIFFLAGSHost initiatedFirmware initiatedInquiry request from hostmust specify interface namescanning ...ioctl AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGWAVELANSIOCSWAVELAN[ %s ]string too longbadly formatted address[ 0x%02xLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ On ][ Off ]NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] %s is already specified to %sa:d:g:hi:m:or:s:A:M:R:D<D<HԈ(hHPX`hpxķȷ̷зԷ| xط,044DC@0123456789;123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz8pX Q(,0(8DHTxhlP0xȷ̷з`Hh/кXܺ Pxhк`( 8,48<\t8Āx<H{+B8P106,B8Dl/<H{i18ЏD //(T"\`/H/HB DLPhB4dhԑd5d /d4DtL|P@ 184B<Dp/jh8,BH (L`dh{Е80TĀtX 84Ā,4Ā4Di|(8x qH{ 8<HXd| 1ĀTtt( (8 P8^X`tĀp3Ā 0<&$(h8*&01028028B( ~H^XHt`Xa8hxdXb8pf8$8}4Ā<Htą@| &$Ā@Dxh!d$LXTdd$L$L$L@T$X/xlԙ$9Ā$LL4P$D(0 Tp||  0<Hdl     0@L\h| 0123456789abcdef01234567 ,8DP\ht<<) HT`ltDl) hp4, h4, 4, , | ) + j, $0<DP+ X+ , `+ htX+ ȇ,  8*@@, @$0 8@HP, i\@-  d,  l-  tX. |x   ԑzx #&'-:+1( 35;897~?>PC=@@@4JO JLMN "@TL (4LP0 `  x ܋ D$0H DLX pt$ HDH DȨ D pn @ ة ,8TX x| l tj m @,0l HLx Dhtn ,v  D x "@D8j tL@ (Cdl "@D "@DH HDd D $ Ȩ HDH T T  "@   @1 4q  d D  k ,8 P l ,p   "@  Db     $ D  0 D ` l  D  f F   HE  @ E   < H ,k h t ܧ E   E  "@@ H  \   tj 4  L X p  f F  p 4 H D , $8\pp d @Dش @Dl DDT @Dl8 "B@ ,, DDP dh  Dte F܋ D(4 LXH Dp|Ȩ Dx D$ Ȱ "@@P @ ,8Ğ \p e F P D0 ,@ Tt @h "@Dp D "@D$0 LXL4  ,|/-\8DP\hrmkxsmkxcolscupcuu1kcub1kcud1kcuf1kcuu1kdch1kdl1kLkedkSkelkEkhomekich1kIkil1kAkindkFkllkHknpkppkrikRrmcuprmsosmcupsmsoError: move: l(%lu) c(%lu) o(%lu)xterm]0;%susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] WARNING: TERM environment variable not set. tcgetattr%s: No terminal database found %s: %s: unknown terminal type signal-resetlines=%lucolumns=%lu016|Vi's standard input and output must be a terminalterminal type unknownerror initializing terminal%s: unknown terminal typetcsetattrinsert linedelete characterjcursor downdelete to eolscroll downgo to eol^go to solinsert at cursordddelete linecursor leftpage upscroll updGdelete to end of screencursor rightcursor upjahakalakf%d233|This terminal has no %s keyfunction key %dstderr046|messages not turned on: %s045|messages not turned off: %stigetnum: linestigetnum: cols002|Line length overflowscript170|Interrupted!#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed083|Count may not be zero084|%s: bad line specification092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discarded094|The second address is smaller than the first$0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0098|The %s command is unknown099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end109|"%s" is not an abbreviation273|Entering ex input mode.[111|No more files to edit112|No previous files to edit113|No previous files to rewind114|No file list to displayecho 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #304|Shell expansion failed289|Shell expansions not supported when the secure edit option is setfdopenvfork118|Error: execl: %s119|I/O error: %s!%s 303|File modified since last write.120|File modified since last complete write; write or use ! to override121|Unable to find home directory location122|New current directory: %s^Dscroll lines[line [,line]] ! commandfilter lines through commands or run commands#ca1[line [,line]] # [count] [l]display numbered lines&[line [,line]] & [cgr] [count] [#lp]repeat the last subsitution* [buffer]execute a buffer<[line [,line]] <[<...] [count] [flags]shift lines left[line] = [flags]display line number[line [,line]] >[>...] [count] [flags]shift lines right@ [buffer][line] a[ppend][!]append input to a lineabbreviateab[brev] [word replace]specify an input abbreviationargsar[gs]display file argument listput a foreground screen into the backgroundchange!ca[line [,line]] c[hange][!] [count]change lines to input!f1ocd[!] [directory]change the current directorychd[ir][!] [directory]copyl1[line [,line]] co[py] line [flags]copy lines elsewhere in the filecscope!scs[cope] command [args]create a set of tags using a cscope commanddeletebca1[line [,line]] d[elete][flags] [buffer] [count] [flags]delete lines from the filew1rdisplay b[uffers] | c[onnections] | s[creens] | t[ags]display buffers, connections, screens or tagsf1o[Ee][dit][!] [+cmd] [file]begin editing another file[Ee]x[!] [+cmd] [file]exusagew1o[exu]sage [command]display ex command usage statementf[ile] [name]display (and optionally set) file name[Ff]g [file]bring a backgrounded screen into the foregroundglobal[line [,line]] g[lobal][!] [;/]RE[;/] [commands]execute a global command on lines matching an REhe[lp]display help statement[line] i[nsert][!]insert input before a linejoin!ca1[line [,line]] j[oin][!] [count] [flags]join lines into a single line[line] k keymark a line position[line [,line]] l[ist] [count] [#]display lines in an unambiguous formmove[line [,line]] m[ove] linemove lines elsewhere in the file[line] ma[rk] keymap!Wmap[!] [keys replace]map input or commands to one or more keysmkexrc!f1rmkexrc[!] filewrite a .exrc file!fN[Nn][ext][!] [+cmd] [file ...]edit (and optionally specify) the next file[line [,line]] nu[mber] [count] [l]change display to number lines[line] o[pen] [/RE/] [flags]enter "open" mode (not implemented)[line [,line]] p[rint] [count] [#l]display linesperlpe[rl] cmdrun the perl interpreter with the commandperldoperld[o] cmdrun the perl interpreter with the command, on each linepre[serve]preserve an edit session for recoveryprevious[Pp]rev[ious][!]edit the previous file in the file argument list[line] pu[t] [buffer]append a cut buffer to the lineq[uit][!]exit ex/vi[line] r[ead] [!cmd | [file]]append input from a command or file to the linerecover[!] filerecover a saved fileresizec+resize [+-]rowsgrow or shrink the current screenrewindrew[ind][!]re-edit all the files in the file argument listrtag!w1orta[g][!] [string]edit the file containing the tag[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]substitute on lines matching an REsc[ript][!] [file]run a shell in a screenwNse[t] [option[=[value]]...] [nooption ...] [option? ...] [all]set options (use ":set all" to see all options)sh[ell]suspend editing and run a shellf1rso[urce] fileread a file of ex commandsst[op][!]suspend the edit sessionsu[spend][!][line [,line]] t line [flags][Tt]a[g][!] [string]tagnexttagn[ext][!]move to the next tagtagpoptagp[op][!] [number | file]return to the previous group of tagstagprevtagpr[ev][!]move to the previous tagtagtoptagt[op][!]discard all tagstcltc[l] cmdrun the tcl interpreter with the commandundou[ndo]undo the most recent changeunabbreviateuna[bbrev] worddelete an abbreviationunmap!w1runm[ap][!] worddelete an input or command map[line [,line]] v [;/]RE[;/] [commands]execute a global command on lines NOT matching an REdisplay the program version informationvisual2c11[line] vi[sual] [-|.|+|^] [window_size] [flags]enter visual (vi) mode from ex mode[Vv]i[sual][!] [+cmd] [file]edit another file (from vi mode only)viusage[viu]sage [key]display vi key usage statement[line [,line]] w[rite][!] [ !cmd | [>>] [file]]write the filewn[line [,line]] wn[!] [>>] [file]write the file and switch to the next filewq[line [,line]] wq[!] [>>] [file]write the file and exit[line [,line]] x[it][!] [file]yankbca[line [,line]] ya[nk] [buffer] [count]copy lines to a cut bufferz3c01[line] z [-|.|+|^|=] [count] [flags]display different screens of the file[line [,line]] ~ [cgr] [count] [#lp]replace previous RE with previous replacement string,addAdd a new cscope databaseadd file | directoryfindQuery the databases for a patternfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameShow help for cscope commandshelp [command]Kill a cscope connectionkill numberresetDiscard all current cscope connections309|Use "cscope help" for helpCSCOPE_DIRS :cscope.outcscope.tpathcd '%s' && exec cscope -dl -f %sexecl: %s310|No cscope connections running%ld%s 278|No matches for querysgdct efi311|%s: unknown search type: use one of %scscope: %d lines%1[ ]%s: "%s" %s doesn't match any cscope command Command: %s (%s) cscope commands: %*s: %s 312|%d: no such cscope sessionNo cscope connections. %2d %s (process %lu) connections123|No cut buffers to displaydefault buffer (line mode) (character mode)********** %s%s filterparent-writerfilter read124|The %s command can't be used as part of a global or v commandpp/etc/vi.exrcNEXINITEXINIT.nexrc.exrc125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writable by a user other than the owner131|No following lines to join.?!132|No input map entries133|No command map entries134|The %s character may not be remapped135|"%s" isn't currently mapped136|Mark names must be a single character137|%s exists, not written; use ! to overrideabbreviate map map! 138|New exrc file: %s139|Destination line is inside move range141|The open command is not yet implemented140|The open command requires that the open option be set306|Vi was not loaded with a Perl interpreter142|Preservation of this file not possible143|File preservedTOOBIG %6ld [ynq]145|Only regular files and named pipes may be read146|%s: read lock was unavailable147|Reading...148|%s: %lu lines, %lu characters149|No background screens to display150|The script command is only available in vi modeemacsemacs:TERMCAPEMACSError: timed outError: shell: EOF151|No command to executescript-shellttypqrs0123456789abcdef; core dumped%.*s%s: received signal: %s%s%.*s%s: exited with status %d%s -iAbort trapAlarm clockBus errorChild exitedContinuedEMT trapFloating point exceptionHangupIllegal instructionInformation requestInterruptI/O possibleIOT trapKilledBroken pipeProfiling timer expiredPower failure imminentQuitSegmentation faultSuspended (signal)Bad system callTerminatedTrace/BPT trapSuspendedStopped (tty input)Stopped (tty output)Urgent I/O conditionUser defined signal 1User defined signal 2Virtual timer expiredWindow size changesCputime limit exceededFilesize limit exceededUnknown signal: %d152|shiftwidth option set to 0RE error: %s153|Count overflow154|Count underflow156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found155|Regular expression specified; r flag meaningless[[:<:]][[:>:]]^.[]$*([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}158|No previous tag entered282|Already at the last tag of this group255|Already at the first tag of this group159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]292|Display too small.%2d ... %*.*s %*.*s%s%.*s164|%s: the tag's line number is past the end of the file166|%s: search pattern not found165|The tags stack is emptyrxglobal -%s '%s'162|%s: tag not found163|%s: corrupted tag in %smunmap302|Vi was not loaded with a Tcl interpreter%6lu Key:%s%s Usage: %s To see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" The %.*s command is unknown Command: %s Usage: %s %*s: %s The %s key has no current meaning 167|%ld more files to edit168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %sVersion 1.79nb16 (10/23/96) The CSRG, University of California, Berkeley.175|The visual command requires that the open option be set%luz%c%lu%luz%c253|Writing...---------------------------------------- /tmp%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file239|%s already locked, session is read-only-c option240|%s: remove241|%s: close242|%s: remove243|%s: remove245|Read-only file, not written244|Read-only file, not written; use ! to override247|%s exists, not written246|%s exists, not written; use ! to override249|Partial file, not written248|Partial file, not written; use ! to override251|%s: file modified more recently than this copy250|%s: file modified more recently than this copy; use ! to override252|%s: write lock was unavailable254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters258|%s expanded into too many file names259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner263|File modified since last complete write; write or use :edit! to override262|File modified since last complete write; write or use ! to override264|File modified since last complete write; write or use ! to override265|File is a temporary; exit will discard modifications266|File readonly, modifications not auto-written177|Empty file079|No non-printable character found276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event003|unable to delete line %lu004|unable to append to line %lu005|unable to insert at line %lu006|unable to store line %lu007|unable to get last line008|Error: unable to retrieve line %lu009|Log file/usr/src/usr.bin/vi/common/log.c010|Logging not being performed, undo not possible011|No changes to undo012|Logging not being performed, undo not possible013|Logging not being performed, roll-forward not possible014|No changes to re-do015|%s/%d: log put error267|Log restartednexnviewviewc:eFGlRrSst:vw:-s option is only applicable to ex.window=%sonly one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.ex/vi: -c$-s017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists020|Error: , %d: 293|added294|changed295|deleted296|joined297|moved298|shifted299|yanked300|line301|lines317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %luLC_MESSAGESVI_MESSAGE_CATALOG030|The file %s is not a message catalog268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: recdir=%s/var/tmp/vi.recoversections=NHSHH HUnhshshell=%sshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%smatchchars=()[]{}<>scroll=%ldwindow=%lu031|Unable to set default %s optionaltweraseautoindentautoprintautowritebackupbeautifycdpathceditcommentedcompatibleerrorbellsescapetimeextendedfilecgtagsmodehardtabsiclowerignorecasekeytimeleftrightlispmagicmatchcharsmatchtimemesgmodelinemsgcatnoprintoctaloptimizeparagraphsrecdirredrawremapreportrulersearchincrsectionssecureshellmetashiftwidthshowmatchshowmodesidescrollslowopensourceanytabstoptaglengthtermtersetildeoptimeoutttywerasew1200w300w9600warnwindownamewraplenwrapmarginwrapscanwriteanyaibfebgthtmodelinesnuoptparascrslowsmsmdswtlttytypewawiwlwmwsCDPATHcdpath=%sdirectory=%sescapetime=1keytime=6matchtime=7msgcat=%s./report=5paragraphs=IPLPPPQPP LIpplpipbppath=%s032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean047|set: the %s option must be in two character groups305|No %s edit option specified%s=%ld%s="%s"set %s set no%s set %s=%-3ld set 033|set: no %s option: 'set all' gives all option values040|Screen columns too small, less than %d041|Screen columns too large, greater than %d042|Screen lines too small, less than %d043|Screen lines too large, greater than %d044|The lisp option is not implemented053|The default buffer is empty054|Buffer %s is empty055|Files with newlines in the name are unrecoverable056|Modifications not recoverable if the session fails057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails060|File backup failed: %s061|Copying file for recovery...062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery fileX-vi-recover-path: Reply-To: rootFrom: root (Vi recovery program)To: Subject: Vi saved the file Precedence: bulk%s%s %s%s %s %s %s%s %s%s %s X-vi-recover-file: , the user was editing a file named on the machine , when it was saved for recovery. You can recover most, if not all, of the changes to this file using the -r option to : -r On %s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s 064|Recovery file buffer overrun065|Recovery filerecdir: %sr+066|%s: malformed recovery file%.24s: %s vi: no files to recover.067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover/usr/sbin/sendmail%s -t < %s071|not sending email: %s072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrapped078|Searching...178|No previous F, f, T or t search179|%s not found[count]^A^A search forward for cursor word[count]^B^B scroll up by screens^C^C interrupt an operation (e.g. read, write, search)[count]^D^D scroll down by half screens (setting count)[count]^E^E scroll down by lines[count]^F^F scroll down by screens^G^G file status[count]^H^H move left by characters[count]^J^J move down by lines^L^L redraw screen[count]^M^M move down by lines (to first non-blank)[count]^N^N move down by lines[count]^P^P move up by lines^R^R redraw screen^T^T tag pop[count]^U^U half page up (set count)^V^V input a literal character^W^W move to next screen[count]^Y^Y page up by lines^Z^Z suspend editor^[ ^[ exit input mode, cancel partial commands^\ ^\ switch to ex mode^]^] tag push cursor word^^^^ switch to previous file[count]' ' move right by columns[count]![count]motion command(s) ! filter through command(s) to motion[count]# +|-|# # number increment/decrement [count]$ $ move to last column % move to match & repeat substitution'['a-z] ' move to mark (to first non-blank)[count]( ( move back sentence[count]) ) move forward sentence[count]+ + move down by lines (to first non-blank)[count], , reverse last F, f, T or t search[count]- - move up by lines (to first non-blank) . repeat the last command/RE[/ offset] / search forward 0 move to first character:command [| command] ... : ex command[count]; ; repeat last F, f, T or t search[count]<[count]motion < shift lines left to motion[count]>[count]motion > shift lines right to motion?RE[? offset] ? search backward@buffer @ execute buffer[count]A A append to the line[count]B B move back bigword[buffer][count]C C change to end-of-line[buffer]D D delete to end-of-line[count]E E move to end of bigword[count]F character F character in line backward search[count]G G move to line[count]H H move to count lines from screen top[count]I I insert before first nonblank[count]J J join lines[count]L L move to screen bottom M move to screen middle N reverse last search[count]O O insert above line[buffer]P P insert before cursor from buffer Q switch to ex mode[count]R R replace characters[buffer][count]S S substitute for the line(s)[count]T character T before character in line backward search U Restore the current line[count]W W move to next bigword[buffer][count]X X delete character before cursor[buffer][count]Y Y copy lineZZZZ save file and exit[[[[ move back section]] move forward section ^ move to first non-blank _ move to first non-blank`[`a-z] ` move to mark[count]a a append after cursor[count]b b move back word[buffer][count]c[count]motion c change to motion[buffer][count]d[count]motion d delete to motion[count]e e move to end of word[count]f character f character in line forward search[count]h h move left by columns[count]i i insert before cursor[count]j j move down by lines[count]k k move up by lines[count]l l move right by columnsm[a-z] m set mark n repeat last search[count]o o append after line[buffer]p p insert after cursor from buffer[count]r character r replace character[buffer][count]s s substitute character[count]t character t before character in line forward search u undo last change[count]w w move to next word[buffer][count]x x delete character[buffer][count]y[count]motion y copy text to motion into a cut buffer[line]z[window_size][-|.|+|^|] z reposition the screen[count]{ { move back paragraph[count]| | move to column[count]} } move forward paragraph[count]~ ~ reverse case207|The Q command requires the ex terminal interface180|No previous file to edit307|No ex command to execute%+ld0X%0*lX0x%0*lx%#0*loabcdefABCDEF181|Cursor not in a number182|Resulting number too large183|Resulting number too small184|No match character on this line185|Matching character not found186|No characters to replace308|Enter to execute a command, :q to exit187|No other screen to switch to188|Characters after search string, line offset and/or z command189|No previous search pattern190|Search wrapped to original position191|Abbreviation exceeded expansion limit: characters discarded192|Illegal character; quote to enter193|Already at the beginning of the insertUnmatched %s194|No more characters to erase195|Movement past the end-of-file196|Movement past the end-of-line197|No cursor movement made198|Already at the beginning of the file199|Movement past the beginning of the file200|Already in the first column201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s206|No characters to delete110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted[count]~[count]motion ~ change case to motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command mode214|Windows option value is too large, max is %lu%d screens backgrounded; use :display to list them212|Cursor not in a word235|Number larger than %lu%7lu ;+=+=+=+=+=+=+=+%.*s 215|Append216|Change217|Command218|Insert219|Replace%lu,%lu220|Movement past the end-of-screen221|Movement past the beginning-of-screen222|Screen must be larger than %d lines to split223|There are no background screens224|There's no background screen editing a file named %s225|You may not background your only displayed screen227|The screen cannot shrink228|The screen cannot grow226|The screen can only shrink to %d rows ,8@PX`hpxȕ [-dfnPpqvy] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]start %s %swait%s: file system is mounted read-write on %s; not checking exec %s for %sexec %sonly one -t option may be specified.dfl:nPpqT:t:vyrq%s has unknown file system type./usr/sbinufsfsck_%sInvalid option stringempty type list,%s-ocannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)%.*s/%s%.*s/r%sCan't stat rootCan't stat %s %s is not a character device realloc failedstrdup failedUNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sCan't open checklist file: %spass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d disk %s: %s in fstab more than once!Changing local password for %s. Old password:New password:Password unchanged.Password is too short.Please enter a longer password.Please don't use an all-lower case password. Unusual capitalization, control characters or digits are suggested.Retype new password:Mismatch; try again, EOF to quit.localcipherCouldn't generate saltminpasswordlenpasswordtimeThe passwd file is busy, waiting...The passwd file is still busy, try again later./etc/master.passwd[-l]usage: %s %s [user] Can't change password.NetBSD ERROR! Different password modules have two different ideas about %c argument format.No valid password module specified.who are you ?? KMGTP***************************************************************************************************************************************************************************************************************************************usage: %s [-z] [-f file] [-l length] [-p prefix] cmd [args...] input sizef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipfork for output pipecould not exec %swriting %u bytes to output pipe|%.*s%*s| %5lld %c%c %3lld.%02d %cB/s - stalled - --:-- ETA%2d:%02d:%02d ETA%3d%% xsignal_restart called with signal %dBLd:psu:v/etc/pwd.db%s%s.tmp%s/etc/pwd.db/etc/spwd.db%s/etc/spwd.db%s.orig%s:*:%d:%d:%s:%s:%s line %d: superuser override in YP inclusionline %d: wheel override in YP inclusionuser `%s' listed twice in password fileuser `%s' not found in password file/etc/passwd+:::::::::at line #%dunlink(%s)attempt to write %s failedtext files and databases are inconsistentre-build the databases without -uusage: pwd_mkdb [-BLps] [-d directory] [-u user] file unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command\ can not be used as a string delimiternewline can not be used as a string delimiter123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthunterminated regular expressionexpected context addresswhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'usage: %s [-aEn] script [file ...] %s [-aEn] [-e script] ... [-f script_file] ... [file ...] ae:f:nEstdout: %s ..."sed: %lu: %s: \%d not defined in the RE\ \abfnrtv%03ofirst RE may not be empty/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZW/etc/ptmp-d-p-u/usr/sbin/pwd_mkdbre-edit the password file? [y]: %s:%s:%d:%d:%s:%ld:%ld:%s:%s:%s %s: entry inconsistent%s: corrupted entry%s: line too long%s: changes not made, no such entry%s%s: unchangedypcipher:%s%s%s%s%c/etc/login.conf%s: couldn't resolve 'tc'%s: 'tc' reference loop%s: getting class information: %m%s: unknown class%s: unexpected cgetent error%s:%d strdup: %m/home/builds/ab/netbsd-3-0-RELEASE/src/lib/libutil/login_cap.c%s:%d malloc: %m%s: unexpected error with capability %s%s: getting capability %s: %m%s:%s=%s: invalid time%s:%s=%s: invalid number%s:%s=%s: invalid size%s-cur%s-max%s: setting resource limit %s: %mgetting resource limit: %m, setuid(%d): %msetlogin(%s) failure: %msetgid(%d): %minitgroups(%s,%d): %mpriority%s: setpriority: %mcould not set PATHinfinityinfautoselect11a11b11gfhEthernetetherTokenRingtokenFDDIIEEE802.1110baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000baseT1000T1000BASE-THomePNA1HPNA110GbaseLR10GLR10GBASE-LRDB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhocibsshostapmonitorturbo-o %s: option not supportedInvalid %s argument `%s'Missing %s argument%s: not owned by root%s: writable by non-rootwarning, unknown root shellInvalid numberexpiration%s `%s' for %s time%s %s `%s'username too long, `%s' > %droot uid should be 0[ `7D\ d7D\ x\ |] l7{ newnewsaltblowfish$sha1$%s%u$:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'    91)! :2*" ;3+# <4,$?7/'>6.&=5-%     #& +6 )4%/7(3-!0,1'8"5.*2$                                                                                                                                     !"#$1234%&'(5678)*+,9:;<-./0=>?@./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz%.*s%s%u%s%u$%.*s$ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$OrpheanBeholderScryDoubt$1$./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz5MS7) OOPSTERMPATH:ZZ.termcap /usr/share/misc/termcap:ZZ=%pQQQQQQQQsQkQlQmQnQoRpRqRr RZRRT,PQRpR R$R(R,R{0Rt4Ru8Rvjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-invalid window sizeincorrect header checkneed more for packet flushneed dictionaryincorrect data check     invalid block typeinvalid stored block lengthsinvalid bit length repeattoo many length or distance symbols deflate 1.1.4 Copyright 1995-2002 Jean-loup Gailly x @z @z  @z         Y[[[[[[[file errorstream errordata errorinsufficient memorybuffer errorincompatible versionstream end       L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`D][al\\ inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeempty distance tree with lengthsincomplete distance treeinvalid literal/length codeinvalid distance code?? bzip2/libbzip2: internal error number %d. This is a bug in bzip2/libbzip2, %s. Please report it to me at: jseward@acm.org. If this happened when you were using some program which uses libbzip2 as a component, you should also report this bug to the author(s) of that program. Please make an effort to report this bug; timely and accurate bug reports eventually lead to higher quality software. Thanks. Julian Seward, 30 December 2001. *** A special note about internal error number 1007 *** Experience suggests that a common cause of i.e. 1007 is unreliable memory or other hardware. The 1007 assertion just happens to cross-check the results of huge numbers of memory reads/writes, and so acts (unintendedly) as a stress test of your memory system. I suggest the following: try compressing the file again, possibly monitoring progress in detail with the -vv flag. * If the error cannot be reproduced, and/or happens at different points in compression, you may have a flaky memory system. Try a memory-test program. I have used Memtest86 (www.memtest86.com). At the time of writing it is free (GPLd). Memtest86 tests memory much more thorougly than your BIOSs power-on test, and may find failures that the BIOS doesn't. * If the error can be repeatably reproduc 08 FXW<   FN* * FXW@@<@TU n7F n7Fy?%vQo`T;"#+hjFir7Wd;fEw;3DDE^Z1(fek=e]J$c&>A|7bEBtO]+H j9GR|S<-{p?&.P([*DCXjޮ* 4g.7^xW#d 'p&PQ15 1iQ́#[[M\a[.@&lI0wk^]!76kU ASZ0ÓDa}d<BףlKӢbM3nqªh)e'T<, 04Hqj~[NuYCQlj6O(uI+z%oiB;K="o Dh׍M3 !1%pv|ItKz«F7w!Y-gNG2p9[誏HLS^\:%H>qMR5_(?DY~S +C0dS"$x f/cx.с/kc`)C>QU*5C0]oh+̍>8DS!{}9G,TfS$eo!Vmrq -<$}jaX;Uӈ3/;jigilqIMa<,Pf365ӑt_ z@->*>RH `h2d1yC=$A/)&Lɭ"bhOp9HX}yG Uj,p'hoU&lL!X"2KtPDc54`;|o{> 4z'%g\Hf;9}CZs0u HKl/rT[ͥ\Gs~Ief'Kg*h-Fw_33FO qs,w,DX7$Jk+eGWK!x۹_rOFbM5϶|kvкilVfPbD W5rX'^ xE(( 0x3t˞P= Vv?{9%`* A^7 ;5X&Symed, this is a bug in bzip2, and I would very much like to hear about it. Please let me know, and, ideally, save a copy of the file causing the problem -- without which I will be unable to investigate it. combined CRCs: stored = 0x%x, computed = 0x%x {0x%x, 0x%x}1.0.2, 30-Dec-2001SEQUENCE_ERRORPARAM_ERRORMEM_ERRORDATA_ERRORDATA_ERROR_MAGICIO_ERRORUNEXPECTED_EOFOUTBUFF_FULLCONFIG_ERRORrt+rld [%d: huff+mtf codes %d code lengths %d, selectors %d, bytes: mapping %d, pass %d: size is %d, grp uses are initial group %d, [%d .. %d], has %d syms (%4.1f%%) %d in block, %d after MTF & 1-2 coding, %d+2 syms in use final combined CRC = 0x%x block %d: crc = 0x%8x, combined CRC = 0x%8x, size = %d reconstructing block ... %6d unresolved strings depth %6d has bucket sorting ... qsort [0x%x, 0x%x] done %d this %d %d pointers, %d sorted, %d scanned main sort initialise ... %d work, %d block, ratio %5.2f too repetitive; using fallback sorting algorithm O%s %d RCMD_CMD/usr/bin/rsh/etc/rmt-lC R%lu W%lu L%lld %d I%d %d %s `%s': illegal number%s %lld is less than %lld.%s %lld is greater than %lld.?option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sPOSIXLY_CORRECT%s: option requires an argument -- %c %s: unknown option -- %c LXtȇԇ$9$0LX t  Ȉ  (@Lp|(*** unknown regexp error code ***REG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routineREG_0x%x HP@Dč$,XHԎ܎-LPTX\`dhltx T      R    ȏ̏Џԏ؏܏|~\|d  !$"4#@$L%\&h't()*+,-Đ-Ԑ.ܐ.//012345 678 9,:(;4<D=P>d?t@[\\]̑^ؑ^__`{ {4|D}P}h~dalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzblankcntrl digitABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~lowerabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ punct!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ upperxdigit0123456789ABCDEFabcdefalnumABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFnewlineVTvertical-tabform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANSUBIS4IS3IS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopzerotwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDEL[:<:]][:>:]] %x:%x:%x:%x:%x:%x %256s %02x:%02x:%02x:%02x:%02x:%02x %x:%x:%x:%x:%x:%x %x:%x:%x:%x:%x:%x/etc/ethersethers.byaddrethers.byname[inet_ntoa error]/var/run/dev.db4@DHPT\dhltxȔ̔Ԕܔ  $(,08@HPX`hpxȕЕSignal 0HUPINTQUITILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGSTOPTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2PWRRT0RT1RT2RT3RT4RT5RT6RT7RT8RT9RT10RT11RT12RT13RT14RT15RT16RT17RT18RT19RT20RT21RT22RT23RT24RT25RT26RT27RT28RT29RT30longjmp botch. __YP! / /0 / /p / /@T / /d4 / /  /|ԣ /@T4 /l,H /  D /d /Hd4 /p /D0d /,4%s: %mpasswd-%umaster.passwd.bynamepasswd.adjunct.byname##passwd.bynamemaster.passwd.byuidpasswd.byuidnsswitch.conf passwd_compat database can't use '%s'dnsniscompatpasswd_compatsetpassentendpwentgetpwent_rgetpwnam_rgetpwuid_rgetpwentgetpwnamgetpwuidsetpwent* / /(%s,%s,%s)netgroup.byusernetgroupnetgroup.byhostlookupnetgroup: Cycle in group `%s'%s.%s ,/etc/netgroup.db: dp%s, %lu: Missing fieldsCannot open `%s'$,4<DLT\dh ,8@PX`hpx/etc/disktabb0b1sfdtscsucssbpxbxfxoxtxdxsimulatedyp_order: clnt_callx@ȕМ؜ fdesckernfsafslibcReal time signal %uUnknown signal: %u$-_.+!*'(),4dlL<H0@\0 h| dxȞܞ,@Th|̟0DXlР@Power fail/restartReal time signal 0Real time signal 1Real time signal 2Real time signal 3Real time signal 4Real time signal 5Real time signal 6Real time signal 7Real time signal 8Real time signal 9Real time signal 10Real time signal 11Real time signal 12Real time signal 13Real time signal 14Real time signal 15Real time signal 16Real time signal 17Real time signal 18Real time signal 19Real time signal 20Real time signal 21Real time signal 22Real time signal 23Real time signal 24Real time signal 25Real time signal 26Real time signal 27Real time signal 28Real time signal 29Real time signal 30( /)0+0- /)<+<- /)$+$-/etc/shellsshells-NNNNNNNNNNshells-%dshellsendusershellgetusershellsetusershell /|O /024|O /0024<6grplistgroup_compatgetgroupmembership /|O /EK|O /|O /FL|O /|O /4G(N|O /|O /0D,K|O /|O /HDDK|O /|O /DK|O /l>DKT />EK\U /8?lE\LU /?FLtV /h@FMW /@4G(NW /T>DKT />HDDKT /=0D,KS/etc/groupgroup-%ugroup.bynamegroup.bygidnsswitch.conf group_compat database can't use '%s'getgrent_rgetgrnam_rgetgrgid_rsetgrentsetgroupentendgrentgetgrentgetgrgidgetgrnamtc%s.dbexecvp: : path too long yp_first: clnt_callyp_next: clnt_call  /etc/hesiod.confHES_DOMAINHESIOD_CONFIGrhs-extensionlhsrhsclassesHS/var/run/ypbind.lockclntudp_createfcntl: F_SETFDYP server for domain %s not responding, still trying clnttcp_create%s/%s.%d/var/yp/binding%s%s%s udptcpCould not get %s transportsvc%s_create: could not open connection%s: %srpc_reg: can't find appropriate transportcan't get protocol infounsupported transport sizeout of memory%s can't reassign procedure number %unetpath%s couldn't register prog %u vers %u for %s%s cant find suitable transport for %ssvc_sendreply failedrpc: rpc_reg: never registered prog %u vers %urpc: rpc_reg trouble replying to prog %u vers %usvc_create: no memorysvc_create: could not register prog %u vers %u on %ssvc_create: unknown protocolsvc_tp_create: invalid netconfig structure for prog %u vers %usvc_tp_create: Could not register prog %u vers %u on %ssvc_tli_create: could not bind to requested addresssvc_tli_create: bad service typesvc_tli_create: could not bind to anonymous portsvc_tli_create: could not get transport informationsvc_tli_create: invalid netconfigsvc_tli_create: could not open connection for %ssvc_dg_create: %scould not get transport information transport does not support data transferout of memorysvc_enablecache: %s %scould not allocate cache cache already enabledcache_set: %svictim not foundvictim alloc failedcould not allocate new rpc bufferdata<clntraw_create - Fatal header serialization error.inetclnt_dg_create: out of memorysunrpcff02::202datagram_nclnt_bcast: Cannot receive reply to broadcastclnt_bcast: Cannot send broadcast packetclnt_bcast: cannot send broadcast packetauthunix_create: out of memoryauth_none.c - Fatal marshalling problemsvc_vc_create: could not retrieve local addrsvc_vc_create: no mem for local addrsvc_vc_create: out of memorysvc_fd_create: could not retrieve local addrsvc_fd_create: could not retrieve remote addrsvc_fd_create: no mem for local addrsvc_tcp: makefd_xprt: out of memorysvc_vc: makefd_xprt: out of memory0.0.0.0.%d.%d/home/builds/ab/netbsd-3-0-RELEASE/src/lib/libc/rpc/clnt_vc.c_clnt_vc_createvc_cv != (cond_t *) NULLvc_cv == (cond_t *) NULLclnt_vc_create: out of memory`GGdGlGtG, function "assertion "%s" failed: file "%s", line %d%s%s%s assertion "%s" failed: file "%s", line %d%s%s%sLIBC_DIAGASSERTLtMMN OOTPPxdrrec_create: out of memory@(TPPT4<Dvisiblecircuit_vdatagram_vcircuit_nudp6tcp6localrpc: failed to open /etc/netconfiginet6%s.%u.%ug|h/dev/urandombad auth_len gid %ld str %ld auth %u Tyyz({p{{{Pyydzz({p{{{Pyxdr_array: out of memoryNETPATHPpNetconfig database not foundNot enough memoryNot initializedNetconfig database has invalid formattpi_cots_ordtpi_cotstpi_cltstpi_rawUnknown network selection error ;; res_send() ;; got answer: ;; Querying server (# %d) address = %s read(vc);; old answer (unexpected): ;; undersized: %d ;; response truncated read failedwrite failedconnect/vcsocket(vc)send;; old answer: ;; wrong query name: ;; truncated answer server rejected query: server rejected query with EDNS0: ;; not our server: recvfrom;; timeout ;; new DG socket connect(dg)socket(dg)res_send: %s ([%s].%s): %s res_send: %s: %s %s%02x%u.%ulink#%ugethostby*.getanswer: asked for "%s", got "%s" / / /gethostby*.getanswer: asked for "%s %s %s", got type "%s"hostsgethostbynamegethostbyaddr%x.%x.ip6.arpa%u.%u.%u.%u.in-addr.arpahosts.byaddripnodes.byaddrhosts.bynameipnodes.byname;; res_nquery: retry without EDNS0;; res_query: send error;; rcode = (%s), counts = an:%d ns:%d ar:%d ;; res_query: mkquery failed;; res_query(%s, %d, %d) ;; res_nquerydomain(%s, %s, %d, %d) HOSTALIASES;; res_nmkquery(%s, %s, %s, %s) ;; res_nopt();; res_opt()... ENDS0 DNSSEC/&ip6.intLOCALDOMAINdomainnameserver;# sortlistoptionsRES_OPTIONSenv;; res_init()... default dnsrch list:;; %s ;; ..END..ndots:;; ndots=%d timeout:;; timeout=%d attempts:;; attempts=%d debug;; debug;; res_setoptions("%s", "%s").. no_tld_queryno-tld-queryrotateno-check-namesedns0dnamenibble:nibble2:v6revmode:singleboth;; res_setoptions("%s", "%s")... ĺPTPTPT /ؼH`|н4Ll /@@ gethostby*.getanswer: asked for "%s", got "%s"SuccessAddress family for hostname not supportedTemporary failure in name resolutionInvalid value for ai_flagsNon-recoverable failure in name resolutionai_family not supportedMemory allocation failureNo address associated with hostnamehostname nor servname provided, or not knownservname not supported for ai_socktypeai_socktype not supportedSystem error returned in errnoInvalid value for hintsResolved protocol is unknownUnknown errorgetaddrinfo0123456789abcdef0123456789ABCDEFyp_match: clnt_callxdr_reference: out of memoryxdr_bytes: out of memoryxdr_string: out of memory0L`x D`t4Ph; errno = %s; s1 = %u, s2 = %u; why = (unknown authentication error - %d); low version = %u, high version = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolRPC: (unknown error code) - Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)/etc/services,/\\#t (8@D\`pt$(4@LPpt  \    4<PXlp8H p3x~ $,PXhlx| !" (08@X`|l#$%(0&<@'PP(X`)| (4HP`h |  ltBADSIGbad signatureBADKEYbad keyBADTIMEbad time;; memory allocation failure ;; ns_sprintrr: %s ; EDNS: version: %u, udp=%u, flags=%04x ;; %s, type = %s, class = %s ;; %s SECTION: ;; ns_parserr: %s ;; ->>HEADER<<- opcode: %s, status: %s, id: %d ; flags:; %s: %d, %s: %d cd ad ?? ra rd tc aa qr;; ns_initparse: %s CHCHAOSHESIODANYNONEQUERYANSWERAUTHORITYADDITIONALZONEPREREQUISITEUPDATERSARSA KEY with MD5 hashDHDiffie HellmanDSADigital Signature AlgorithmEXPIREONLYNo algorithmPRIVATEAlgorithm obtained from OIDPKIXPKIX (X.509v3) CertificateSPKISPKI certificatePGPPGP certificateURLURL PrivateOID Privatename serverMDmail destination (deprecated)MFmail forwarder (deprecated)CNAMEcanonical nameSOAstart of authoritymailboxMGmail group memberMRmail renamenullWKSwell-known service (deprecated)PTRdomain name pointerHINFOhost informationMINFOmailbox informationMXmail exchangerTXTRPresponsible personAFSDBDCE or AFS serverX25X25 addressISDNISDN addressrouterNSAPnsap addressNSAP_PTRPXmapping informationGPOSgeographical position (withdrawn)AAAAIPv6 addressLOClocationNXTnext valid name (unimplemented)EIDendpoint identifier (unimplemented)NIMLOCNIMROD locator (unimplemented)SRVserver selectionATMAATM address (unimplemented)TKEYtkeyTSIGtransaction signatureIXFRincremental zone transferAXFRZXFRcompressed zone transferMAILBmailbox-related data (deprecated)MAILAmail agent (deprecated)NAPTRURN Naming AuthorityKXKey ExchangeCERTCertificateA6IPv6 AddressDNAMESINKKitchen Sink (experimental)OPTEDNS Options"any"NOERRORno errorFORMERRformat errorSERVFAILserver failedNXDOMAINno such domain nameNOTIMPnot implementedREFUSEDrefusedYXDOMAINdomain name existsYXRRSETrrset existsNXRRSETrrset doesn't existNOTAUTHnot authoritativeNOTZONENot in zoneBADTYPETYPE%dBADCLASSCLASS%ddnsrchprimry(unimpl)init?0x%lx?aaonly(unimpl)usevcrecursigntcdefnamstyopninsecure2insecure1noaliasesdnssecno-nibble2[af%d]%lu.%.2lu%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %s%d.%.2dm %sm %sm %sm; error: unknown LOC RR version%04d%02d%02d%02d%02d%02dCLASSIQUERYCQUERYMCQUERYUNOTIFY1013ZONEINITZONEREF\# %tu%s ; %s%02x ; ( ; serial ; refresh ; retry ; expiry ; minimum %u ( %s %d %d %lu 0x%04x %u %u ; key_tag= %u%u %u %d %d %d record too long to print ) %u bytesunknown RR type%u %u %u @ %s %sRR format error "\len <= *buflen/home/builds/ab/netbsd-3-0-RELEASE/src/lib/libc/nameser/ns_print.cABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=%s:%d: %s(%s)%s%s failed. REQUIREENSUREINSISTINVARIANT%u.%u.%u.%u%d%c0123456789  \[x%1x/%d] / / /%s (%d source%s): TRYAGAIN=return NOTFOUND=return UNAVAIL=return SUCCESS=continuenss_%s.so.%dnss_module_register/etc/nsswitch.conf<%d>%h %e %T syslog: unknown facility/priority: %x/var/run/log%m/%d/%y%Y-%m-%d%H:%M%H:%M:%S%04d%2d%03d%I:%M:%S %p%e-%b-%YWILDABBRGMTmn/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec%.3s %.3s%3d %02d:%02d:%02d %d $048<@DHLPTX\`ht|@SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %YUnknown error: %u/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%L/usr/share/nls/nls.aliasNLSPATH8|l@|xvDLC_COLLATELC_MONETARYLC_NUMERICPATH_LOCALE/usr/share/locale%s/%s/%s/%s/%s/%sPOSIX/force%s/locale.alias`t(<PĂl(<Pp$Hd(D\| 0Tp0Thx(<Ph4`x^Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too large or too smallResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisc quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIdentifier removedNo message of desired typeValue too large to be stored in data typeIllegal byte sequenceNot supportedOperation CanceledBad or Corrupt messageNo message availableNo STREAM resourcesNot a STREAMSTREAM ioctl timeoutAttribute not foundLOOKUP%s/%s/LC_CTYPECODESET=RuneCT10BSDCTYPE  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%$sniglet^&%s/bt.XXXXXX 0000000000000000bug in vfprintf: bad base0123456789ABCDEFINFnanNAN(null)}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMD7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~mpool_new: page allocation overflow. error: warning: brk(2) failed [internal error] mmap(2) failed, check limits. unknown char in MALLOC_OPTIONS. MALLOC_OPTIONS/etc/malloc.confallocation failed. junk pointer, too low to make sense. modified (chunk-) pointer. chunk is already free. pointer to wrong page. modified (page-) pointer. junk pointer, too high to make sense. in malloc():out of memory. recursive call. in free(): in realloc():page is already free. freelist is destroyed. cs_path\X bc_base_max bc_dim_max8 bc_scale_maxd bc_string_max coll_weights_max expr_nest_max D line_max  re_dup_max  posix2_version, X  posix2_c_bind  posix2_c_dev  posix2_char_termH posix2_fort_dev posix2_fort_run posix2_localedef@ posix2_sw_devt posix2_upe stream_max tzname_maxT atexit_max/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesThe maximum ibase/obase values in the bc(1) utilityThe maximum array size in the bc(1) utilityThe maximum scale value in the bc(1) utilityThe maximum string length in the bc(1) utilityThe maximum number of weights that can be assigned to any entry of the LC_COLLATE order keyword in the locale definition fileThe maximum number of expressions that can be nested within parenthesis by the expr(1) utilityThe maximum length in bytes of a text-processing utility's input lineThe maximum number of repeated occurrences of a regular expression permitted when using interval notationThe version of POSIX 1003.2 with which the system attempts to complyWhether the system's C-language development facilities support the C-Language Bindings OptionWhether the system supports the C-Language Development Utilities OptionWhether the system supports at least one terminal type capable of all operations described in POSIX 1003.2Whether the system supports the FORTRAN Development Utilities OptionWhether the system supports the FORTRAN Runtime Utilities OptionWhether the system supports the creation of localesWhether the system supports the Software Development Utilities OptionWhether the system supports the User Portability Utilities OptionThe minimum maximum number of streams that a process may have open at any one timeThe minimum maximum number of types supported for the name of a timezoneThe maximum number of functions that may be registered with atexit(3)Resolver Error 0 (no error)Unknown hostHost name lookup failureUnknown server errorNo address associated with nameResolver internal errorUnknown resolver error/var/run/rpcbind.sock127.0.0.1::1             ]:[= libc nsdispatch: %s line %d: %s '%s'error addingduplicate source'compat' used with other sourceslibc nsdispatch: %s line %d: %syacc stack overflowsyntax errorerror adding entry           !#$%&'()*+,-./0123456789:;<=>?@ACDEFGHJKMOQSS    DEAE216+-.99+&%/ /E!()*!!# E:::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::;<;53210/-,+*)('&%$#"!  ::::::::::::::::::::::::fatal flex scanner internal error--no action foundlibc nsdispatch: %minput in flex scanner failedinput buffer overflow, can't enlarge buffer because scanner uses REJECTfatal flex scanner internal error--end of buffer missedout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()bad buffer in yy_scan_bytes()out of dynamic memory in yy_scan_bytes()libc nsdispatch: %s line %d: %s at '%s'HASH: Out of overflow pages. Increase page size _hashXXXXXX@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1997, 1998, 2003, 2004 Matthew R. Green All rights reserved. @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1991, 1993 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. @(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1997, 1998, 1999 Bill Paul. All rights reserved.@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993, 1994, 1995, 1996 Keith Bostic. All rights reserved. @(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 2000 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. MDOMDOMM0)M|MG@!M|~M`MHNN P0,N0 $N0 "@ 0N ~ abcdfiklnoprstuvwxABDEGHLMPTUXYZhg@x`XP8OLTlx|`XP8pgn(@x``XP8xgn(@L``XP8M(r=PtPp=wDptpXPsg(@{0{|Pp8{<DptpXP8 gg ibijgj$c5fih$ik4ilDimXiodiopipipipiqiriujtiviwiwixdxMziziBhC jOjP(jS0jT >>) && || | *status% # termthen~time/tmp/shunaliasuserverbosewordcharstt6`fҾ`$p$$$$$$$% %0%D%T%h%|%%%%%%%&&(&<&`&t&&&&&'D'd'x''''''((,(<(X(d(x(((((c( < ((),)<)T)x))))))**,*@*P*\*|*****+8+T+x+++++++ ,(,D,X,h,,,,,,,, -(-@-\-h-x----(f '" ;&<>()|^%P.X.,switchwhileif/L//0G//@///$u/$u/84#8pX/x../`//t/\/L/d0 00". 0\(0X &00X`.80@04H0pP0<X0L`0x|h0p08zx000x0`00f0L00t00Я0t`0000;/ ///4/x..// 0 . M 00<>()@ 7H:::::::/:; ; ;; @i$;@,;@@@......zzzzz{{L{T{h{p{{{{d{{L{{L{"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)̆L0@P\hxđȇЇ\؇~0@HX`hP0pa(|b0@p<B8(c@xTdHȉHAePX0L`fXF``gh$Php\ixTlċjL$4J!hXxkHlHLmȌ،n"t  o@OLpH8PtXqPdr"̍s!dTlS!tTu"Vw" Dxx ($X(Aȏy0|(z8Ld"@~H!l?PȦ#XԐ.`A, (press RETURN)... (interrupt to abort)xDyy381ĒԒ `xsAԕB,C@`xmDEܖd,rL\gxF%M-R(8aT d   *ĘA $`/dev/ptyXX\^:   }) 0H"| и Ը  {}abcdDgGhHilnNpPqrs tw xy !:#= cc/dev/XtyXX!.......//. /d1p18/0t1:1111 1 1@1@1`11t1:HLh#1#1#1#1#1$1$1$2$2$2%2% 2%(2%,2%42&<2&H2&P2'\2'h2'p2(|2(2(2)2)2)2*2*2*2+2+2+2,3, 3,3,3-$3-03-43-<3.H3.T3.\3/h3/t3/|30303031313232323C3C3D3D3E4E4F4F$4c,4c84d<4dH4e1eL4#T4#`4&p4&4444444444444444445 5 5@5@<}(50585@5L5X5 `5 h5 p5@x5@5@5@5@5@5`5`555555x7:,|r1ssr9rsr:r;rrps0sr0r8r$rrrssssr@rDslrrsHrrsts`rsIc3n+ecc1^'Oo;{mqi_IzOU!jrRd!3M\cX~Twb)bUfXDu&6(GwCji \0BO$`>a[p_#^]bc4aDOrvoQr} ,5NWN`~YfkD|Rdpk)w4X^QX%.Nq}E) f3&bwA@ir~o<8.);W8V^l;lw0IWa:v6Il1l=RWq&'; $z<P5+R?# %85e&`z=jnt7& {drY 2lrefRZl~n; &C vkkMPG&"֊/aK+d 5ӆ1 Cͼ-}wp4mG0K=V9'C#=.r *ϝxO K} xV|iqލuݓklRobfF^[^Z}Wf`Sc0M-ZI D@ƥ d'NK`%#/+6lA/ ]D@hf+*{Pu&6>;;kvqUP2M_}1>φ˃4y:Z iYmێ`7Od2z~\sKwV OK86F+GB{\=fX@US]CQ;%)&!,G^(BM6P2,v?kZ;&H VM#RV/K`mpl +e= hﶻ'؀odj#ͳ`~>ɐ}:{y`6q}[Fu2 t-0q].KYT@PENOJ+ GC!}{`COFr[v hJGl0a$-eK^VZp0m5= ^[ Q7R3?>:З$:V -T)y&;h+̠ȥPMlk/|vˡv`#ds'ě yg:Ջb}>  q+2h6mf{u]6@ (ylE q&TsY ) }$339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž/dev/4[x[hZXYl| 33""::@tT(.`33 (3333<CC  33p33UU33UU33UU`($`( |`(t 333333 ʚ;5ym8@ E80uy 3333 333333333333333333333333333333333333 d'@Bʚ; 8(X|`*$1(,8x   @  333333 3333 CCCCCCCZaaP 33RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~HD$X @܎ \`(t8tIp S@| @[ d e 8 l  { H   p 8d0 d  t  h P XT `x    |       0d p| $t 1 B P`" "% %&]d q&T &|( 0)v/2-,T+x*.<.H(.4+  4+- -- -$. (.|. .X/ &3 ANZhx $(,0 /|0 042 @22ld342 2\3 d33 34 44L5(t688H9:)8x 89 $99 9: :; ;< <8<pT?Bh?< h?L?LAUhcdAT dA\G GJqz J JKl,lK| KN  PN PNN N@ NO   P PP  # 0P P(Q \ ĵ ̵ (h x L \з C  ĸ и R` X x n |}8 <@ @(t (|   Td d  T hp(hu8$7  =  $  B(,P  W  b@ @ q   T ` {X( 4T X h(L h  t  , 4@ @0`P`P P $ $Bc8 T8  d'*$  2  | 2'5H| =8 G,L`X< he| sxd}E F F F    F D (, , ( (T   $  8   <   P 0x  04 x PT TT(4   ," "# $`' 8 '<( T() )(T(|dF F !x&L)\/)98*LF*O2X*b 3l7 L)) )v8 * 8*x* ** *l9(2 23 333x 3;0<6 777 78 8P9`9  `9; ;< <H> `>>T4d >@ LAB CE TEE f E0F  o J X ` dT Xw  H `}    4 l t4 "" D D    HD | l TH Td t8 Hp P  ` l  t0 t  l  D     4    ! T \ !!L!!  t   '!Ph l  .! 4!5!"$D" X"" ";!<$,$ <$C!$H$%I!PP!V!$ \!& b!( k!, q!0 y!4 !8 ,%!9  '& &!,,!@ ,!HV,!.P . .0 T19 99!@  9!$O!L!><>!D >p@ A!,FxE!@ !B@ !« ,F!GHG GG $H!KXI IJ dJK KO $O P P!TdT T@V HVpV tVV!< V"lZZ lZ^"^ ^_ _X` x`a (aa ab b@c Dc f fPf Tf"$gth hdi li" i""jhxj*"H j0"jj j6"kk k<"mPm mD"nn nI"dp`p dpN"\qT"XrZ"TsL_"td"t upu uv Dw&| M&R& Y&`&\@ i&q&xw& t |&l x&&        T \|   x& &|:H |0 P X& `(& 0 \&Bc `\ p&B c 2p0` p& &&``&d 'd$ '` T'\ < TT'hl h h p   4 8  L P\ d%'0 $2'(t (  L Td='d hG'h N'h h8W't _'H H h't   H T( H\ `tp'l xv''t $L'x L' '| ' '| ' `'  ' 'D'p '$ $' t' 8 D( h(t t( (( 4  4 3(8  8  >( h , J(0 h 0    S(  `  p $ ^(, , , l  g(Lt<t(XP X}(l( ( ( ( (4 D( L(   $ (( ( ( (D( )   ) ) '), /)0 :)d  C)l#P)  W)( _)< e)P 0 |  $ n)X  X  {) 4 !)d )4 "<" D"" "$# 4#`$ h$% h'3 4))$))@ )D )H )L )6 66 6@7*\7l \78 8H8*P80 P8|8#*8 8.*h9T9 99 9:9*:  :>*:<J*:DL; ; < (<= => >@?V*P H?4@ <@]*AAh*X AA A,E tEF FF FFu*Fx F(G*,G ,GLG*PG PGpG tGG GH HxI 2D HK2 TL\2 \ h2 x2< 2  $2 2 0`2x x2p20,X \2 2`  2(l (2 8 D|   33xL x 3L  P \ %3,3 @43 :3 A3 H3  S3d\3T h e38 ,p30P {3@ x3 P T` d , 0p  $d  3 @   $  8 `  d  3  8  @  33BpD3 \  3 d X3 3` `330 0 d3p p43< < 4 x4|x | 4L <*4@ @740 0x F4 xT4$ a4 <m4HX Hz44`x4 4, 4  84L L20   H 4 ` !4@ 44 48 4< 44НH48! 8!44 " "h"4 t"0# 4#@$ P$`% d%% %& &( (( () )) )t* *, ,(,45D 0,5-P58.5/|)53h.51\- -4. 8.65(2/ //B5/( //H5/  //N5/( /0U50  0 0 $0]51Dp1 12 3x3d5 3n588x5454 448 8895 950?`5P;h: :5>x5@5H 5AX> >50A(? 0?x@ @B555(58P B6ED DtF FdH tH0J PJJ 6 J68N0N 8NpN N6 Q$Y#6 (Y[ \(64$` `06Lx?6 k 8k n |nn oJ6Dd| |R6~ ~~   h 4  H L Ď H \]6 Џ  i6 u6(|6 Е6($ ($ ( ( D6 (6X6ܤ|6(6@ L XԮ6 6 <6 86 Hx666`7L747+7 077\ D7`R7` D L^7$g7hq7X|7$T hH X 477  7d7<P d   t x   $7 7  L78( 874 7 7((7 P7 7  8L$ L8 %8,$ 008 P T:8$D8 p P8 Z8  |c8 m8 y8 8 8 8  8 h8   8  @ 8 x 8  8 | t 8 8 8PL P8$9 9l" !9" 29TP Td" l">9h$Dd$ h$I9 (&P9 <&Y9 &d' h'l) |)d9+\+hp'L( ++k9 +v9,x|1|9 129 29 p39,:8 8: <9WL 0L9XU9S9OO OS STU XU W WW WxX YZ Z\ \]9 ]9s<9Lu9o4Ta Xa b bb b9fhf pfi i9k:Pl:8k:mL8n Dnq q q s s8u Lu#:v v v.:|d::{H:L|tV:zz z{ {`:$}h: }}q: }z:( T :D 8 D: ą:  4 X@: \  h : Dd: h: :, d: l: ԙ(: 0 :$:\ | ;D  ĩ;4 4( D |   ; , 0T d( <#;); p2;;; P XE;pP;  0 <[;th;4 w;h X  + ~;h 0 4p t` dP Td h;  ;d;D H   T d( H| `  `]B h;$@ ;dl , $X d, ;<` l ;5t   ;;h x ;      4 l       0;ĭ8  `  p     T  d \  l      $    x   ;$! l!  $! X!  h! x"  " "  " %  & & ;' ;'  &  '  ' (  ( 8) < <) )  ) +  + +  + < . 4 < 4 !<TF dX6  l6 ,<9 7  7 9<F C<,E x9  9 =  > @  @ L<E xE  ,E E  E F  F 4G P0 DG lI  pI 1U<XK  XK a<T T  U LU  dU U l< U @\  H\ 5 4_ r< Db d y< d Dd  Xd <4h d  d <Dh P@h  Dh h << h < j <p Tpj  tj $k  ,k l  l l  l l  l m  m Xp  dp <,s <|u <s $s  ,s < v xu  |u << v <|} P\}  |} }  } } < } <  =$ =X    = ܋ x  = $ &=H 0+=5=x A=| M= x ؕ Y= d  h g= \ o=$ 8  X w= = Ğ П  t = x  =  = =4 Ĩ  Ȩ = = ==P 0d  D  P |  Դ = ش = d  = x >  > > h#>(   ->P 4>( <  <> dG> Q> ^> : j> u>   >d > P> > > `  >   >   (    >  > d > p > ,       ,  0 X  ` l  p    , > H >X    ?   $  ?4 , ? 0 (  , ?  #?  )? p 3?  8?t( ?? (   E?8% <N?4*    U?. [?- c?, k?P+ %  8% l(  t( 0*  4* L+  P+ ,  , -  x- -  - .  . ,/  \/ u? / ;  ; T= ?? X= ?  ? LA  TA ?O ?E D  E ?\O d?L ?M K  K O  O P ? P ?R X? a 4?He ? Te ? \m m  m @8s @(u @v (p  8p *@H 6@ z  { B@ $M@{ V@ |   ȅ     b@ 8   m@d   d  h X  d v@d}@d`@@ @ @ 0   x @H @@ 2x 8@ @D 4@ ܞ @  @x x @  @ X@p   x   @  H @ `إ  ܦ  l  p < A D L AA x  AAt Ax "A| ĩ  ̩ ة  ܩ      ܪ  p  t (A , 3A 4     ȭ      < B0 IBP OB@ [B  I9 ,  D    fB    $ t  x       $ P  d t lB  rB( | \     xBBX\\  B B B p BP B(   4 BT B B B Bx Bt  C ` C< l < 'C   l 3CX x T  t   @  T   (   |    :CX   P DC` X